2. GPCR/G Protein
  3. Amylin Receptor
  4. NN1213 acetate

NN1213 acetate, a long-acting human amylin peptide analog, is a selective Amylin receptor agonist with EC50 values of 0.177 and 0.262 nM for hAMY3R and rAMY3R, respectively. NN1213 acetate significantly reduces food intake and fat mass. NN1213 acetate can reduce body weightin diet-induced obese rats. NN1213 acetate can be used for the research of obesity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

NN1213 acetate

NN1213 acetate Chemical Structure

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg In-stock
100 mg In-stock
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Other Forms of NN1213 acetate:

NN1213 acetate Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

NN1213 acetate, a long-acting human amylin peptide analog, is a selective Amylin receptor agonist with EC50 values of 0.177 and 0.262 nM for hAMY3R and rAMY3R, respectively. NN1213 acetate significantly reduces food intake and fat mass. NN1213 acetate can reduce body weightin diet-induced obese rats. NN1213 acetate can be used for the research of obesity[1][2].

In Vitro

NN1213 acetate shows EC50 values of 0.177 and 0.262 nM for hAMY3R and rAMY3R[1].
NN1213 acetate shows binding affinity values of 0.561 and 0.29 nM for hAMY3R and rAMY3R[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

NN1213 acetate Related Antibodies
In Vivo

NN1213 (0.7-22 nmol/kg; s.c.; daily; 21 days) acetate produces dose-dependent body weight loss in diet-induced obese rats[1].
NN1213 (3-100 nmol/kg; s.c.; single dose) acetate produces a dose-dependent, long-duration reduction in food intake in rats[1].
NN1213 (3-300 nmol/kg; s.c.; single dose) acetate produces a dose-dependent, long-duration reduction in food intake in beagle dogs[1].
NN1213 (10 nmol/kg; s.c.; daily; 17 days) acetate decreases body weight and food intake in diet-induced obese rats[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Rat (diet-induced obese, fed high-energy diet)[1]
Dosage: 0.7 nmol/kg (3 µg/kg); 2.2 nmol/kg (10 µg/kg); 6.6 nmol/kg (30 µg/kg); 22 nmol/kg (100 µg/kg)
Administration: s.c.; daily; 21 days
Result: Transiently reduced food intake, with maximal suppression during days 1-2; by day 15, food intake was close to vehicle control levels but still slightly reduced.
Produced dose-dependent body weight loss: the 0.7 nmol/kg group lost 4.7% of baseline body weight, while the 2.2, 6.6, and 22 nmol/kg groups lost 8.7-9.3% of baseline body weight.
Over 21 days, the 0.7 nmol/kg group lost 32.0 ± 3.6 g, and the 22 nmol/kg group lost 69.6 ± 7.5 g (equivalent to 90.7% of initial body weight).
Confirmed via magnetic resonance imaging that body weight loss was primarily driven by a dose-dependent reduction in fat mass, with minimal effects on lean mass.
Molecular Weight

4553.10 (free base)

Formula

C198H316N56O63S2.xC2H4O2
Appearance

Solid

Color

White to off-white

Sequence

{Lys(γGlu-γGlu-C20 diacid)}-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Arg-His-Ser-Ser-Pro-Asn-Phe-Gly-Ala-Ile-Pro-Ser-Ser-Thr-Asn-Val-Gly-Ser-Arg-Thr-Tyr-NH2 (disulfide bridge:Cys2-Cys7)
Sequence Shortening

{Lys(γGlu-γGlu-C20 diacid)}-CNTATCATQRLADFLRHSSPNFGAIPSSTNVGSRTY-NH2 (disulfide bridge:Cys2-Cys7)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.65%

SDS (252 KB)

COA (277 KB) RP-HPLC (111 KB) MS (215 KB) Elemental Analysis Report (135 KB)

Handling Instructions (2659 KB)
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

NN1213 acetate Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

NN1213NN 1213NN-1213Amylin ReceptorAMYRHuman amylin peptide analogAmylin receptorAgonistAntiobesityInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NN1213 acetate
Cat. No.:
HY-P11245A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.