1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. Activin A Receptor Type 2B (ACVR2B)
  6. ACVR2B Protein, Human/Cynomolgus (HEK293, His)

ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3. ACVR2B Protein, Human/Cynomolgus (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 116 amino acids (S19-T134).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3[1]. ACVR2B Protein, Human/Cynomolgus (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 116 amino acids (S19-T134).

Background

Activin receptor type-2B (ACVR2B), also known as ActR-IIB and MGC116908, is an activin type II receptor. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors[1].
The sequence of amino acids in ACVR2B proteins from different species is very stable, which leads to the conclusion that in the process of evolution, ACVR2B has been only slightly altered, and that both in humans and in animals, its function is similar.
Activins and growth differentiation factors (GDF) bind to ACVR2B, which in turn activate type I receptors such as activin receptor-like kinases (ALK) ALK4 and ALK5, activating downstream molecule SMAD2/3. SMADSs regulate a number of myogenic genes, such as myoD, myogenin, and Myf5, that are involved in cellular hypertrophy, proliferation, or differentiation. Noncanonical ACVR2B pathways have also been shown to regulate MAP kinases. ACVR2B blocks signaling of myostatin, its close homolog GDF11, as well as activin A, activin B, and BMP10[1]. Activin A primarily binds to the type 1 receptors ALK4 or ALK7 in complex with ACVR2A or ACVR2B, causing activation of SMAD2 or SMAD3[2].
In myeloma cells, BMP-6- and BMP-9-induced activation of SMAD1/5/8 through ACVR2A/ACVR2B/ALK2 is inhibited by activin A treatment[2]. ACVR2B has been shown to preserve muscle mass and prolong survival in tumor hosts, and to increase bone mass in models of osteogenesis imperfecta and muscular dystrophy[3].

In Vitro

Recombinant human ACVR2B (5 μg/mL) inhibits the effects of BMP-9 on INA-6 and IH-1 cells[2].

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its ability to neutralize Activin-mediated inhibition on MPC11 cell proliferation. The ED50 for this effect is 0.1-0.5 µg/mL in the presence of 10 ng/mL recombinant Activin A (HY-P70311).

  • Measured by its ability to neutralize Activin-mediated inhibition on MPC11 cell proliferation. The ED50 for this effect is 0.1292 µg/mL in the presence of 10 ng/mL recombinant Activin A, corresponding to a specific activity is 7.740×103 units/mg.
Assay Procedure

Cell Culture
Cell Line for activity assay: MPC-11 cells
Cell Culture Medium: DMEM+10% HS+1% P/S
Test protein: Activin A Protein, Human/Mouse/Rat (HEK293) (HY-P70311)
Penicillin-Streptomycin (100×), Sterile (HY-K1006)
Cell Counting Kit-8 (CCK8 solution, HY-K0301)

Procedure
1. Seed cells at a density of 10,000 cells per well in a 96-well plate, with a volume of 50 μL per well. (Do not seed cells in the outermost ring of the 96-well plate; instead, add an equal volume of PBS solution.)
2. Add 50 μL of DMEM complete medium (DMEM high-glucose medium + 10% HS + 1% P/S + 10 ng/mL Activin A) containing different concentrations of ACVR2B protein to the 96-well plate, resulting in final concentrations of 0, 0.000001, 0.00001, 0.0001, 0.001, 0.01, 0.1, 0.5, 1, 5, 10, 20, and 50 μg/mL of ACVR2B protein in each well.
3. Incubate the cells at 37°C in a 5% CO2 incubator for 72 hours.
4. After the incubation period, add 10 μL of CCK-8 solution to each well under light-protected conditions and incubate at 37°C in a 5% CO2 incubator for 2 hours.
5. Measure the OD value at 450 nm using a microplate reader.
6. Using GraphPad Prism software, plot a curve with OD values on the y-axis and protein concentration on the x-axis to calculate the ED50 value.

Species

Human; Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

Q13705-1 (S19-T134)/XP_045242398.1 (S40-T155)

Gene ID

93  [NCBI]/102118668

Molecular Construction
N-term
ACVR2B (S19-T134)
Accession # Q13705-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuActivin receptor type 2B, His; ACVR-2B; Activin receptor type 2B
AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT

Molecular Weight

Approximately 25-38 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ACVR2B Protein, Human/Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACVR2B Protein, Human/Cynomolgus (HEK293, His)
Cat. No.:
HY-P7456
Quantity:
MCE Japan Authorized Agent: