ADAM9 Protein, Human (208a.a, HEK293, His)
ADAM9, a metalloprotease, cleaves and releases TEK, KDR, EPHB4, CD40, VCAM1, and CDH5, playing a pivotal role in tumorigenesis and angiogenesis. It regulates cell motility through integrin interactions, mediates cell-cell and cell-matrix interactions, and may act as an alpha-secretase for APP, suggesting involvement in neurobiology and neurodegenerative disorders. ADAM9 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived ADAM9 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ADAM9, a metalloprotease, cleaves and releases TEK, KDR, EPHB4, CD40, VCAM1, and CDH5, playing a pivotal role in tumorigenesis and angiogenesis. It regulates cell motility through integrin interactions, mediates cell-cell and cell-matrix interactions, and may act as an alpha-secretase for APP, suggesting involvement in neurobiology and neurodegenerative disorders. ADAM9 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived ADAM9 protein, expressed by HEK293, with C-His labeled tag.
Background
ADAM9, a metalloprotease, plays a pivotal role in tumorigenesis and angiogenesis by cleaving and releasing various molecules including TEK, KDR, EPHB4, CD40, VCAM1, and CDH5. Its multifaceted functions extend to mediating cell-cell and cell-matrix interactions, thereby regulating cell motility through interactions with integrins. Additionally, ADAM9 may function as an alpha-secretase for the amyloid precursor protein (APP), highlighting its involvement in processes relevant to neurobiology and neurodegenerative disorders.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q13443-1 (A206-S413)
-
Gene ID8754
-
Molecular Construction
-
N-term
-
ADAM9 (A206-S413)
Accession # Q13443 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
ADAM9; Myeloma Cell Metalloproteinase; Prev. CORD9; A Disintegrin And Metalloproteinase Domain 9 (Meltrin Gamma); MDC9; ADAM Metallopeptidase Domain 9 (Meltrin Gamma); MCMP; Meltrin Gamma; KIAA0021; Meltrin-Gamma; Mltng; ADAM9 Protein; Disintegrin And Met
-
AA Sequence
AVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYS
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under non reducing (N) conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)