ADAM9 Protein, Human (208a.a, HEK293, His)

ADAM9, a metalloprotease, cleaves and releases TEK, KDR, EPHB4, CD40, VCAM1, and CDH5, playing a pivotal role in tumorigenesis and angiogenesis. It regulates cell motility through integrin interactions, mediates cell-cell and cell-matrix interactions, and may act as an alpha-secretase for APP, suggesting involvement in neurobiology and neurodegenerative disorders. ADAM9 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived ADAM9 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADAM9, a metalloprotease, cleaves and releases TEK, KDR, EPHB4, CD40, VCAM1, and CDH5, playing a pivotal role in tumorigenesis and angiogenesis. It regulates cell motility through integrin interactions, mediates cell-cell and cell-matrix interactions, and may act as an alpha-secretase for APP, suggesting involvement in neurobiology and neurodegenerative disorders. ADAM9 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived ADAM9 protein, expressed by HEK293, with C-His labeled tag.

Background

ADAM9, a metalloprotease, plays a pivotal role in tumorigenesis and angiogenesis by cleaving and releasing various molecules including TEK, KDR, EPHB4, CD40, VCAM1, and CDH5. Its multifaceted functions extend to mediating cell-cell and cell-matrix interactions, thereby regulating cell motility through interactions with integrins. Additionally, ADAM9 may function as an alpha-secretase for the amyloid precursor protein (APP), highlighting its involvement in processes relevant to neurobiology and neurodegenerative disorders.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADAM9 (A206-S413)
      Accession # Q13443
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    ADAM9; Myeloma Cell Metalloproteinase; Prev. CORD9; A Disintegrin And Metalloproteinase Domain 9 (Meltrin Gamma); MDC9; ADAM Metallopeptidase Domain 9 (Meltrin Gamma); MCMP; Meltrin Gamma; KIAA0021; Meltrin-Gamma; Mltng; ADAM9 Protein; Disintegrin And Met

  • AA Sequence

    AVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYS

  • Predicted Molecular Mass

    24.6 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under non reducing (N) conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00