Copy Link Print Information

ADCYAP1R1 Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

The ADCYAP1R1 protein is a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP) and recognizes PACAP-27 and PACAP-38. Through the G protein, this receptor activates adenylyl cyclase, initiating multiple downstream signaling pathways. ADCYAP1R1 Protein, Human (HEK293, hFc) is the recombinant human-derived ADCYAP1R1 protein, expressed by HEK293, with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ADCYAP1R1 Protein, Human (HEK293, hFc)
  • ADCYAP1R1 Protein, Human (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The ADCYAP1R1 protein is a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP) and recognizes PACAP-27 and PACAP-38. Through the G protein, this receptor activates adenylyl cyclase, initiating multiple downstream signaling pathways. ADCYAP1R1 Protein, Human (HEK293, hFc) is the recombinant human-derived ADCYAP1R1 protein, expressed by HEK293, with C-hFc labeled tag.

Background

The ADCYAP1R1 protein functions as a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP), specifically recognizing both PACAP-27 and PACAP-38. Operating through G proteins, this receptor activates adenylyl cyclase, initiating downstream signaling pathways. It is implicated in the regulation of various hormonal releases, including adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. Additionally, ADCYAP1R1 may play a role in spermatogenesis and sperm motility, contributing to smooth muscle relaxation and secretion in the gastrointestinal tract. Its interaction with PACAP is facilitated through the N-terminal extracellular domain, highlighting its crucial involvement in diverse physiological processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    P41586 (M21-A155)

  • Gene ID
    117
  • Molecular Construction
    • N-term
    • ADCYAP1R1 (M1-A155)
      Accession # P41586
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ADCYAP1R1; PAC1 Receptor; ADCYAP Receptor Type I; PACAP-R1; PAC1R; Pituitary Adenylate Cyclase Activating Polypeptide 1 Receptor Type I Hiphop Splice Variant; Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor; Pituitary Adenylate Cyclase

  • AA Sequence

    MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKA

  • Predicted Molecular Mass

    41.4 kDa

  • Molecular Weight

    Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • ADCYAP1R1 Protein, Human (HEK293, hFc) Product Image
    1/16
  • Experimental Validation Results for ADCYAP1R1 Protein, Human (HEK293, hFc)
  • ADCYAP1R1 Protein, Human (HEK293, hFc) Product Image