1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Amphiregulin
  5. Amphiregulin Protein, Human

Amphiregulin Protein, an EGFR ligand, serves as an autocrine growth factor and mitogen for various cells, including astrocytes, Schwann cells, and fibroblasts. It promotes cellular proliferation and interacts with CNIH in its immature precursor stage. Amphiregulin's EGFR activation underscores its role in essential cellular processes, emphasizing its significance as a regulator of cell growth and function in diverse cell types. Amphiregulin Protein, Human is the recombinant human-derived Amphiregulin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Amphiregulin Protein, Human Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Amphiregulin Protein, an EGFR ligand, serves as an autocrine growth factor and mitogen for various cells, including astrocytes, Schwann cells, and fibroblasts. It promotes cellular proliferation and interacts with CNIH in its immature precursor stage. Amphiregulin's EGFR activation underscores its role in essential cellular processes, emphasizing its significance as a regulator of cell growth and function in diverse cell types. Amphiregulin Protein, Human is the recombinant human-derived Amphiregulin protein, expressed by E. coli , with tag free.

Background

Amphiregulin, a ligand for the EGF receptor (EGFR), acts as an autocrine growth factor and mitogen for diverse target cells, including astrocytes, Schwann cells, and fibroblasts. Its role extends to promoting cellular proliferation, and it engages in interactions with CNIH during its immature precursor stage. Amphiregulin's ability to activate EGFR suggests its involvement in key cellular processes and highlights its significance as a regulator of cell growth and function in various cell types.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤124.1 ng/mL, corresponding to a specific activity is ≥8058 U/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 124.1 ng/mL, corresponding to a specific activity is 8058 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P15514 (S101-K198)

Gene ID

374  [NCBI]

Molecular Construction
N-term
Amphiregulin (S101-K198)
Accession # P15514
C-term
Protein Length

Partial

Synonyms
Amphiregulin; AR; Colorectum Cell-Derived Growth Factor; CRDGF; AREG; SDGF; AREGB
AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Molecular Weight

14-17 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Amphiregulin Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Amphiregulin Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amphiregulin Protein, Human
Cat. No.:
HY-P70578
Quantity:
MCE Japan Authorized Agent: