Copy Link Print Information

Amphiregulin Protein, Human

Customer Review

Based on 1 Customer Validation

Amphiregulin Protein, an EGFR ligand, serves as an autocrine growth factor and mitogen for various cells, including astrocytes, Schwann cells, and fibroblasts. It promotes cellular proliferation and interacts with CNIH in its immature precursor stage. Amphiregulin's EGFR activation underscores its role in essential cellular processes, emphasizing its significance as a regulator of cell growth and function in diverse cell types. Amphiregulin Protein, Human is the recombinant human-derived Amphiregulin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Amphiregulin Protein, Human
  • Experimental Validation Results for Amphiregulin Protein, Human
  • Amphiregulin Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Amphiregulin Protein, an EGFR ligand, serves as an autocrine growth factor and mitogen for various cells, including astrocytes, Schwann cells, and fibroblasts. It promotes cellular proliferation and interacts with CNIH in its immature precursor stage. Amphiregulin's EGFR activation underscores its role in essential cellular processes, emphasizing its significance as a regulator of cell growth and function in diverse cell types. Amphiregulin Protein, Human is the recombinant human-derived Amphiregulin protein, expressed by E. coli , with tag free.

Background

Amphiregulin, a ligand for the EGF receptor (EGFR), acts as an autocrine growth factor and mitogen for diverse target cells, including astrocytes, Schwann cells, and fibroblasts. Its role extends to promoting cellular proliferation, and it engages in interactions with CNIH during its immature precursor stage. Amphiregulin's ability to activate EGFR suggests its involvement in key cellular processes and highlights its significance as a regulator of cell growth and function in various cell types.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤124.1 ng/mL, corresponding to a specific activity is ≥8058 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P15514 (S101-K198)

  • Gene ID
    374  [NCBI]
  • Molecular Construction
    • N-term
    • Amphiregulin (S101-K198)
      Accession # P15514
    • C-term
  • Protein Length

    Partial

  • Synonyms

    AREG; AR; Prev. AREGB; Schwannoma-Derived Growth Factor; Prev. SDGF; Amphiregulin B; CRDGF; Amphiregulin; Colorectum Cell-Derived Growth Factor

  • AA Sequence

    SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 124.1 ng/mL, corresponding to a specific activity is 8058 U/mg.

  • Amphiregulin Protein, Human Product Image
    1/16
  • Experimental Validation Results for Amphiregulin Protein, Human
  • Experimental Validation Results for Amphiregulin Protein, Human
  • Amphiregulin Protein, Human Product Image