Animal-Free FGF basic/bFGF Protein, Human (145a.a)
Based on 1 Customer Validation
FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization.Animal-Free FGF basic/bFGF Protein, Human (145a.a), consists of 145 amino acids, produced by E.coli with tag free.This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].Animal-Free FGF basic/bFGF Protein, Human (145a.a), consists of 145 amino acids, produced by E.coli with tag free.This product is for cell culture use only.
FGF-2/bFGF is a member of the fibroblast family and has a high affinity for heparin. FGF-2 plays an important role in tendon to bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 specifically binds to tyrosine kinase receptors and activates the FGF/FGFR signaling pathway. Subsequently, FGF-2 influences cell proliferation, differentiation and apoptosis, as well as immune regulation by transducing other classical pathways. For example, FGF-2 regulates the JAK-STAT signaling pathway to regulate cartilage metabolism. FGF-2 also acts as a mitotic promoter to accelerate cell proliferation. Therefore, (1) FGF-2 is an important growth factor in the healing process of ligament/tendon injury. In vitro experiments, low-dose FGF-2 can stimulate the proliferation and differentiation of bone marrow mesenchymal stem cells, and up-regulate the mRNA expression of type I/III collagen and fibronectin. However, high doses of FGF-2 did not stimulate extracellular matrix (ECM) protein proliferation and gene expression. (2) FGF-2 is also an endogenous and intrinsic growth factor in cartilage repair. FGF-2 binds to heparan sulfate proteoglycan and is stored in the ECM of articular cartilage. When cartilage is damaged or degenerated, ECM rapidly releases FGF-2 and activates ERK signaling pathways to promote cartilage regeneration. FGF-2 exhibits a biphasic effect in combination with its specific receptor. FGF-2 combined with FGFR3 promoted the repair of articular cartilage. FGF-2 combined with FGFR1 promoted the degeneration of articular cartilage[1]. FGF-2 is expressed in granulosa cells and colliculus cells, as well as hepatocellular cancer cells, but not in non-cancerous liver tissues. This reveals the role of FGF-2 in brain tumors, particularly glioblastoma. According to studies, FGF-2 is a known carcinogenic factor in GBM. FGF-2 increases the self-renewal of glioblastoma stem cells and contributes to the growth and vascularization of glioma[2]. FGF-2 protein is highly conserved in some species, and the similarity rate of human FGF-2 protein sequence to rat, mouse, and bovine was 97.4%, 95.45%, and 98.71%, respectively.
1.Measure by its ability to induce NIH-3T3 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human FGF-2 is approximately >5 x 105IU/mg.
2. Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 for this effect is 0.3187 ng/mL, corresponding to a specific activity is 3.137×106 U/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P09038-4 (A144-S288)
-
Gene ID2247
-
Molecular Construction
-
N-term
-
bFGF (A144-S288)
Accession # P09038-4 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF2; BFGF; Prev. FGFB; Basic Fibroblast Growth Factor; Fibroblast Growth Factor 2 (Basic); Fibroblast Growth Factor; Heparin-Binding Growth Factor 2; Prostatropin; HBGF-2; FGF2A; FGF-2; FGF; Fibroblast Growth Factor 2; Basic Fibroblast Growth Factor BFGF
-
AA Sequence
ALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
-
Predicted Molecular Mass
18.1 kDa
-
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 1 M NaCl, pH 7.4.
2. Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 M NaCl, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.1 EU/μg, determined by LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
