1. Recombinant Proteins
  2. Others
  3. APOC2 Protein, Human (His)

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the study genetic hypertriglyceridemia caused by ApoC-II deficiency.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the study genetic hypertriglyceridemia caused by ApoC-II deficiency[1].

Background

APOC2 Protein, Human (His), which is present in chylomicrons, very low density lipoproteins (VLDL), and high density lipoproteins (HDL), is the LPL activator[1].

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P02655 (T23-E101)

Gene ID

344

Molecular Construction
N-term
APOC2 (T23-E101)
Accession # P02655
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuApolipoprotein C-II, His; ApoC2; Apolipoprotein C-II
AA Sequence

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Predicted Molecular Mass
10 kDa
Molecular Weight

Approximately 13 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

APOC2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

APOC2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APOC2 Protein, Human (His)
Cat. No.:
HY-P7529A
Quantity:
MCE Japan Authorized Agent: