APOC2 Protein, Human (His)
Based on 1 Customer Validation
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the study genetic hypertriglyceridemia caused by ApoC-II deficiency.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the study genetic hypertriglyceridemia caused by ApoC-II deficiency[1].
APOC2 Protein, Human (His), which is present in chylomicrons, very low density lipoproteins (VLDL), and high density lipoproteins (HDL), is the LPL activator[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P02655 (T23-E101)
-
Gene ID344
-
Molecular Construction
-
N-term
-
APOC2 (T23-E101)
Accession # P02655 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOC2; Apo-CII; Apolipoprotein C2; APO-CII; Apolipoprotein C-II; APOC-II; ApoC-II; APC2
-
AA Sequence
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
-
Predicted Molecular Mass
10 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
