1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Biotinylated Proteins
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. APRIL Proteins
  6. APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi)

APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi)

Cat. No.: HY-P700661
Handling Instructions Technical Support

APRIL/TNFSF13 is a TNF superfamily cytokine that affects tumor cell growth by binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Its homotrimeric structure highlights a potential role in oncogenic processes and immune functions involving monocytes and macrophages. APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi) is the recombinant human-derived APRIL/TNFSF13 protein, expressed by HEK293 , with N-Flag, C-Avi, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APRIL/TNFSF13 is a TNF superfamily cytokine that affects tumor cell growth by binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Its homotrimeric structure highlights a potential role in oncogenic processes and immune functions involving monocytes and macrophages. APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi) is the recombinant human-derived APRIL/TNFSF13 protein, expressed by HEK293 , with N-Flag, C-Avi, N-His labeled tag.

Background

APRIL/TNFSF13, a cytokine of the tumor necrosis factor (TNF) superfamily, exerts its biological effects through binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Functioning as a homotrimer, APRIL/TNFSF13 is implicated in the modulation of tumor cell growth, highlighting its potential significance in oncogenic processes. Additionally, APRIL/TNFSF13 may play a role in immunological processes mediated by monocytes and macrophages. Through its interactions with specific receptors, APRIL/TNFSF13 contributes to the intricate regulatory networks governing cell behavior and immune responses. Elucidating the multifaceted functions of APRIL/TNFSF13 provides valuable insights into its role in health and disease, particularly in the context of tumor biology and immune system regulation.

Biological Activity

Immobilized Human BCMA, hFc Tag at 0.5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human APRIL (Trimer) , His Tag with the EC50 of ≤16.3ng/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

N-Avi;N-8*His;N-Flag

Accession

O75888-1 (K112-L250)

Gene ID
Molecular Construction
N-term
8*His-Avi-Flag
APRIL (K112-L250)
Accession # O75888-1
C-term
Protein Length

Partial

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
CD256; TALL2; TALL-2; TNFSF13; APRIL; APRILFLJ57090; TRDL1; TRDL-1; ZTNF2; 2310026N09Rik
AA Sequence

KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Predicted Molecular Mass
52.1 kDa
Molecular Weight

Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20mM PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi)
Cat. No.:
HY-P700661
Quantity:
MCE Japan Authorized Agent: