APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi)

APRIL/TNFSF13 is a TNF superfamily cytokine that affects tumor cell growth by binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Its homotrimeric structure highlights a potential role in oncogenic processes and immune functions involving monocytes and macrophages. APRIL/TNFSF13 Trimer Protein, Human (Biotinylated, HEK293, Flag, His-Avi) is the recombinant human-derived APRIL/TNFSF13 protein, expressed by HEK293 , with N-Flag, C-Avi, N-His labeled tag.

APRIL/TNFSF13, a cytokine of the tumor necrosis factor (TNF) superfamily, exerts its biological effects through binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Functioning as a homotrimer, APRIL/TNFSF13 is implicated in the modulation of tumor cell growth, highlighting its potential significance in oncogenic processes. Additionally, APRIL/TNFSF13 may play a role in immunological processes mediated by monocytes and macrophages. Through its interactions with specific receptors, APRIL/TNFSF13 contributes to the intricate regulatory networks governing cell behavior and immune responses. Elucidating the multifaceted functions of APRIL/TNFSF13 provides valuable insights into its role in health and disease, particularly in the context of tumor biology and immune system regulation.

Immobilized Human BCMA, hFc Tag at 0.5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human APRIL (Trimer) , His Tag with the EC₅₀ of ≤16.3ng/ml determined by ELISA.

Human

HEK293

N-Avi;N-8*His;N-Flag

O75888-1 (K112-L250)

8741  [NCBI]

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20mM PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.