1. Recombinant Proteins
  2. Others
  3. Alpha 1-Microglobulin Protein, Human (P.pastoris, His)

Alpha 1-Microglobulin Protein, Human (P.pastoris, His)

Cat. No.: HY-P75476
Handling Instructions Technical Support

Alpha 1-microglobulin has multiple antioxidant and repairing effects, with reductase, heme-binding and free radical scavenging activities. Within blood vessels, it regulates red blood cell homeostasis and prevents heme- and reactive oxygen species-induced cell damage. Alpha 1-Microglobulin Protein, Human (P.pastoris, His) is the recombinant human-derived Alpha 1-Microglobulin protein, expressed by P. pastoris , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Alpha 1-microglobulin has multiple antioxidant and repairing effects, with reductase, heme-binding and free radical scavenging activities. Within blood vessels, it regulates red blood cell homeostasis and prevents heme- and reactive oxygen species-induced cell damage. Alpha 1-Microglobulin Protein, Human (P.pastoris, His) is the recombinant human-derived Alpha 1-Microglobulin protein, expressed by P. pastoris , with N-His labeled tag.

Background

The Alpha 1-Microglobulin protein serves as a multifaceted antioxidant and tissue repair agent, showcasing reductase, heme-binding, and radical-scavenging activities. Operating both intravascularly and extravascularly, it actively removes and shields against harmful oxidants, facilitating repair of macromolecules in various cellular compartments. Intravascularly, the protein plays a regulatory role in red cell homeostasis by preventing heme- and reactive oxygen species-induced cell damage, safeguarding fetal and adult red blood cells from hemolysis. It also reduces extracellular methemoglobin, converting it back to the oxygen-carrying form deoxyhemoglobin. In instances of acute inflammation, it inhibits oxidation of low-density lipoprotein particles, thereby limiting vascular damage. Extravascularly, the protein protects against oxidation products on extracellular matrix structures and cell membranes, catalyzing the reduction of carbonyl groups on oxidized collagen fibers. Notably, it counteracts oxidative damage at the blood-placenta interface, preventing the leakage of free fetal hemoglobin into the maternal circulation. Intracellularly, the protein maintains mitochondrial redox homeostasis, preserving mitochondrial ATP synthesis and protecting renal tubule epithelial cells from heme-induced oxidative damage. Additionally, it exhibits chaperone activity in facilitating the correct folding of bikunin in the endoplasmic reticulum, and it acts as a Kunitz-type serine protease inhibitor and structural component of the extracellular matrix, contributing to extracellular space remodeling and cell adhesion. It further participates in the I-alpha-I complex, facilitating the transfer of heavy chains to hyaluronan in the presence of TNFAIP6, a process critical for extracellular matrix proteoglycan structure remodeling. The protein's diverse functions extend to inhibiting proteases involved in airway inflammation, cytotoxic responses, and matrix metalloproteinase activation, as well as playing a role in cumulus oophorus expansion during ovulation and inhibiting calcium oxalate crystallization.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

P02760 (A206-L348)

Gene ID

259  [NCBI]

Molecular Construction
N-term
His
AMBP (A206-L348)
Accession # P02760
C-term
Protein Length

Partial

Synonyms
Alpha-1-microglobulin; Protein HC; ITI-LC; Bikunin; AMBP
AA Sequence

AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELL

Predicted Molecular Mass
17.4 kDa
Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Alpha 1-Microglobulin Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Alpha 1-Microglobulin Protein, Human (P.pastoris, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Alpha 1-Microglobulin Protein, Human (P.pastoris, His)
Cat. No.:
HY-P75476
수량:
MCE Japan Authorized Agent: