BIRC8 Protein, Human (GST)
BIRC8 Protein, Human (GST) is the recombinant human-derived BIRC8, expressed by E. coli, with GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BIRC8 Protein, Human (GST) is the recombinant human-derived BIRC8, expressed by E. coli, with GST labeled tag.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag GST
-
Accession
Q96P09 (T2-S236)
-
Gene ID/
-
Protein Length
Full Length
-
Synonyms
BIRC8; HILP2; Baculoviral IAP Repeat Containing 8; Baculoviral IAP Repeat-Containing Protein 8; ILP-2; Testis-Specific Inhibitor Of Apoptosis; Inhibitor Of Apoptosis-Like Protein 2; Baculoviral IAP Repeat-Containing 8; IAP-Like Protein 2; ILP2; RNF136
-
AA Sequence
TGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
-
Predicted Molecular Mass
53.6 kDa
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
