BPHL Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (His) is the recombinant human-derived BPHL protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (His) is the recombinant human-derived BPHL protein, expressed by E. coli , with N-His labeled tag.

Background

BPHL protein, a serine hydrolase, serves as a catalyst for the hydrolytic activation of amino acid ester prodrugs, exemplified by nucleoside analogs like valacyclovir and valganciclovir. Notably, it facilitates the conversion of valacyclovir to acyclovir through hydrolysis. Beyond its role in drug activation, BPHL is implicated in potential detoxification processes. As a specific alpha-amino acid ester hydrolase, it displays a preference for small, hydrophobic, and aromatic side chains, without imposing strict requirements on the leaving group, except for a preference toward a primary alcohol. Existing as a monomer, BPHL may also engage in the formation of homodimers.

Verified Bioactivity

Defined as the amount of valacyclovir that 1μg of BPHL can hydrolysis at 37°C for 1 minute. The specific activity is 25.264 pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • BPHL (S38-Q291)
      Accession # Q86WA6
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    BPHL; Biphenyl Hydrolase-Related Protein; Prev. MCNAA; Serine Hydrolase BPHL; VACVase; Valacyclovirase; Bph-Rp; Biphenyl Hydrolase-Like (Serine Hydrolase Breast Epithelial Mucin-Associated Antigen), Isoform CRA_a; Breast Epithelial Mucin-Associated Antige

  • AA Sequence

    SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

  • Molecular Weight

    Approximately 31 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00