1. Recombinant Proteins
  2. Others
  3. BPTF Protein, Human (His)

BPTF proteins are regulatory subunits in the NURF-1 and NURF-5 ISWI chromatin remodeling complexes that assemble ordered nucleosome arrays to access DNA during replication, transcription, and repair. The NURF-1 complex is critical for brain development and actively regulates the expression of En1 and En2. BPTF Protein, Human (His) is the recombinant human-derived BPTF protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BPTF proteins are regulatory subunits in the NURF-1 and NURF-5 ISWI chromatin remodeling complexes that assemble ordered nucleosome arrays to access DNA during replication, transcription, and repair. The NURF-1 complex is critical for brain development and actively regulates the expression of En1 and En2. BPTF Protein, Human (His) is the recombinant human-derived BPTF protein, expressed by E. coli , with N-6*His labeled tag.

Background

BPTF protein functions as a regulatory subunit within the ATP-dependent NURF-1 and NURF-5 ISWI chromatin remodeling complexes, orchestrating the assembly of ordered nucleosome arrays on chromatin to facilitate DNA access during essential processes such as DNA replication, transcription, and repair. The NURF-1 ISWI chromatin remodeling complex, characterized by a lower ATP hydrolysis rate compared to NURF-5, plays a pivotal role in brain development by binding to the promoters of En1 and En2, positively regulating their expression. BPTF, as a histone-binding protein, exhibits a preference for H3 tails trimethylated on 'Lys-4' (H3K4me3), a marker for transcription start sites of active genes, and interacts with dimethylated H3 tails to a lesser extent. Beyond histone binding, BPTF may directly regulate transcription through interaction with DNA or transcription factors. It interacts with MAZ and KEAP1 and is a crucial component of the NURF-1 ISWI chromatin remodeling complex, which includes SMARCA1, BPTF, RBBP4, and RBBP7. Additionally, BPTF forms the catalytically inactive BPFT-SMARCA1 complex and is a component of the NURF-5 ISWI chromatin remodeling complex with SMARCA5/SNF2H. These interactions underscore the multifaceted role of BPTF in chromatin dynamics and transcriptional regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q12830 (D2865-A3033)

Gene ID

2186

Molecular Construction
N-term
6*His
BPTF (D2865-A3033)
Accession # Q12830
C-term
Protein Length

Partial

Synonyms
BPTF; Nucleosome-remodeling factor subunit BPTF; Bromodomain and PHD finger-containing transcription factor; Fetal Alz-50 clone 1 protein; Fetal Alzheimer antigen
AA Sequence

DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BPTF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BPTF Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BPTF Protein, Human (His)
Cat. No.:
HY-P701612
Quantity:
MCE Japan Authorized Agent: