BPTF Protein, Human (His)
BPTF proteins are regulatory subunits in the NURF-1 and NURF-5 ISWI chromatin remodeling complexes that assemble ordered nucleosome arrays to access DNA during replication, transcription, and repair. The NURF-1 complex is critical for brain development and actively regulates the expression of En1 and En2. BPTF Protein, Human (His) is the recombinant human-derived BPTF protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
BPTF proteins are regulatory subunits in the NURF-1 and NURF-5 ISWI chromatin remodeling complexes that assemble ordered nucleosome arrays to access DNA during replication, transcription, and repair. The NURF-1 complex is critical for brain development and actively regulates the expression of En1 and En2. BPTF Protein, Human (His) is the recombinant human-derived BPTF protein, expressed by E. coli , with N-6*His labeled tag.
Background
BPTF protein functions as a regulatory subunit within the ATP-dependent NURF-1 and NURF-5 ISWI chromatin remodeling complexes, orchestrating the assembly of ordered nucleosome arrays on chromatin to facilitate DNA access during essential processes such as DNA replication, transcription, and repair. The NURF-1 ISWI chromatin remodeling complex, characterized by a lower ATP hydrolysis rate compared to NURF-5, plays a pivotal role in brain development by binding to the promoters of En1 and En2, positively regulating their expression. BPTF, as a histone-binding protein, exhibits a preference for H3 tails trimethylated on 'Lys-4' (H3K4me3), a marker for transcription start sites of active genes, and interacts with dimethylated H3 tails to a lesser extent. Beyond histone binding, BPTF may directly regulate transcription through interaction with DNA or transcription factors. It interacts with MAZ and KEAP1 and is a crucial component of the NURF-1 ISWI chromatin remodeling complex, which includes SMARCA1, BPTF, RBBP4, and RBBP7. Additionally, BPTF forms the catalytically inactive BPFT-SMARCA1 complex and is a component of the NURF-5 ISWI chromatin remodeling complex with SMARCA5/SNF2H. These interactions underscore the multifaceted role of BPTF in chromatin dynamics and transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q12830 (D2865-A3033)
-
Gene ID2186
-
Molecular Construction
-
N-term
-
6*His
-
BPTF (D2865-A3033)
Accession # Q12830 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BPTF; Nucleosome-Remodeling Factor Subunit BPTF; Prev. FALZ; Bromodomain And PHD Domain Transcription Factor; FAC1; Nucleosome Remodeling Factor, Large Subunit; Fetal Alzheimer Antigen; Fetal Alz-50 Reactive Clone 1; NURF301; BPTF Protein; Bromodomain And
-
AA Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)