BRPF3 Protein, Human (His)

The BRPF3 protein is a scaffold in various HAT complexes such as MOZ/MORF and HBO1 and is critical for histone H3 acetylation, especially in directing the specificity of KAT7/HBO1 for H3K14ac. In the HBO1 complex, BRPF3 promotes DNA replication initiation and activates replication origins. BRPF3 Protein, Human (His) is the recombinant human-derived BRPF3 protein, expressed by E. coli , with N-6*His labeled tag.

BRPF3, serving as a scaffold subunit in diverse histone acetyltransferase (HAT) complexes, including MOZ/MORF and HBO1, is instrumental in histone H3 acetylation activities. Particularly, in the HBO1 complex, BRPF3 plays a crucial role in directing the specificity of KAT7/HBO1 towards acetylation of histone H3 at 'Lys-14' (H3K14ac), thereby facilitating the initiation of DNA replication and promoting the activation of replication origins. As part of the MOZ/MORF complex, BRPF3 collaborates with key components such as ING5, KAT6A, KAT6B, and MEAF6. Moreover, BRPF3 is a vital member of specific HBO1 complexes composed of KAT7/HBO1, MEAF6, and ING4 or ING5. The direct interaction between BRPF3 and KAT7/HBO1 highlights its role as a critical mediator in these HAT complexes, shedding light on its involvement in the intricate regulation of histone acetylation and DNA replication processes.

Human

E. coli

N-6*His

Q9ULD4 (D1056-G1195)

27154

Partial

DYNGSGRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRG

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.