Copy Link Print Information

Cardiotrophin-1/CTF1 Protein, Rat

Customer Review

Based on 1 Customer Validation

Cardiotropin-1/CTF1 protein plays a key role in inducing cardiomyocyte hypertrophy in vitro. Its effects on myocardial development and enlargement are mediated through binding and activation of ILST/gp130 receptors. Cardiotrophin-1/CTF1 Protein, Rat is the recombinant rat-derived Cardiotrophin-1/CTF1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Cardiotrophin-1/CTF1 Protein, Rat Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Cardiotropin-1/CTF1 protein plays a key role in inducing cardiomyocyte hypertrophy in vitro. Its effects on myocardial development and enlargement are mediated through binding and activation of ILST/gp130 receptors. Cardiotrophin-1/CTF1 Protein, Rat is the recombinant rat-derived Cardiotrophin-1/CTF1 protein, expressed by E. coli , with tag free.

Background

Cardiotrophin-1/CTF1 protein takes on a pivotal role as it induces hypertrophy in cardiac myocytes in vitro, emphasizing its influence on cellular processes associated with heart muscle development and enlargement. The protein's functional impact is mediated through its binding to and activation of the ILST/gp130 receptor, revealing a specific molecular pathway through which Cardiotrophin-1/CTF1 exerts its effects. This interaction underscores its significance in signaling cascades related to cardiac myocyte responses, providing insights into the regulatory mechanisms that contribute to the modulation of cardiac hypertrophy.

Verified Bioactivity

1.Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/mL, corresponding to a specific activity of >2.0x106 IU/mg.
2.Measured in a cell proliferation assay using CTF1 human erythroleukemic cells. The ED50 for this effect is 5.936 ng/mL, corresponding to a specific activity is 1.685×10^5 units/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q63086 (M1-A203)

  • Gene ID
    29201  [NCBI]
  • Molecular Construction
    • N-term
    • CTF1 (M1-A203)
      Accession # Q63086
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CTF1; CT1; Cardiotrophin 1; Cardiotrophin-1; CT-1; Cardiophin 1

  • AA Sequence

    MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA

  • Predicted Molecular Mass

    21.4 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Cardiotrophin-1/CTF1 Protein, Rat Product Image
    1/16
  • Cardiotrophin-1/CTF1 Protein, Rat Product Image