CD200 Protein, Mouse (HEK293, His)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
Free Sample		Apply now
5 μg	$93	In-stock	Estimated Time of Arrival: December 31
10 μg	$148	In-stock	Estimated Time of Arrival: December 31
20 μg	$237	In-stock	Estimated Time of Arrival: December 31
50 μg	$450	In-stock	Estimated Time of Arrival: December 31
100 μg		Get quote
250 μg		Get quote

* Please select Quantity before adding items.

CD200 Protein, Mouse (HEK293, His) Featured Recommendations:

Biological Activity	Measured by its binding ability in a functional ELISA . Immobilized recombinant mouse CD200 at 1 μg/mL (100 μl/well) can bind mouse CD200R1/Fc with a linear range of 1.5-200 ng/mL.
Species	Mouse
Source	HEK293
Tag	C-His
Accession	O54901 (M1-G232)
Gene ID	17470 [NCBI]
Synonyms	OX-2 membrane glycoprotein; CD200; MOX1; MOX2; My033
AA Sequence	MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
Molecular Weight	Approximately 24 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE
Appearance	Solution.
Formulation	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	N/A.
Storage & Stability	Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping	Shipping with dry ice.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (220 KB) Handling Instructions (2659 KB)

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.