CD200 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues.Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities.CD200 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues.Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities.CD200 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD200 protein plays a pivotal role in immune modulation, functioning as a costimulatory molecule that promotes T-cell proliferation. Additionally, CD200 is implicated in the potential regulation of myeloid cell activity across various tissues, as suggested by similarity-based inferences. The interaction between CD200 and its receptor, CD200R1, is facilitated through their respective N-terminal Ig-like domains. This interaction likely contributes to the regulatory processes involved in immune responses and myeloid cell function. The engagement of CD200 with CD200R1 underscores its significance in mediating immune cell communication and homeostasis, emphasizing its potential as a key player in immunomodulation.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA . Immobilized recombinant mouse CD200 at 1 μg/mL (100 μl/well) can bind mouse CD200R1/Fc with a linear range of 1.5-200 ng/mL.
2.Measured by its binding ability in a functional ELISA . Immobilized recombinant mouse CD200 at 2 μg/mL (100 μl/well) can bind mouse CD200R1/Fc with a linear range of 500-1000 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD200 (Q31-G232)
      Accession # O54901
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD200; CD200 Antigen; Prev. MOX1; MRC; Prev. MOX2; Antigen Identified By Monoclonal Antibody MRC OX-2; OX-2 Membrane Glycoprotein; CD200 Antigen, Isoform CRA_b; CD200 Molecule; OX-2

  • AA Sequence

    QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG

  • Predicted Molecular Mass

    24 kDa

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00