1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD28
  5. CD28 Protein, Canine (HEK293, mFc)

CD28 Protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules. CD28 Protein, Canine (HEK293, mFc) is the recombinant canine-derived CD28 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD28 Protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules. CD28 Protein, Canine (HEK293, mFc) is the recombinant canine-derived CD28 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

CD28 plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules, including DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2. Isoform 3 specifically interacts with CD40LG, highlighting its multifaceted role in mediating immune responses and cellular signaling pathways[1][2].

Species

Canine

Source

HEK293

Tag

C-mFc

Accession

Q9GKP3 (T18-P153)

Gene ID
Molecular Construction
N-term
CD28 (T18-P153)
Accession # Q9GKP3
mFc
C-term
Protein Length

Partial

Synonyms
CD28 antigen (Tp44); CD28 molecule; CD28; MGC138290
AA Sequence

TENKILVKQLPRLVVYNNEVNLSCKYTYNLFSKEFRASLYKGVDSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRNLFVNQTDIYFCKIEVMYPPPYIGNEKSNGTIIHVKEKHLCPDELFPDSSKP

Molecular Weight

50-70 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD28 Protein, Canine (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD28 Protein, Canine (HEK293, mFc)
Cat. No.:
HY-P77622
Quantity:
MCE Japan Authorized Agent: