CD34 Protein, Human (Biotinylated, HEK293, Fc)
CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD34 protein is a potential adhesion molecule that is thought to play a crucial role in early hematopoiesis by facilitating the attachment of stem cells to the extracellular matrix of the bone marrow or directly to stromal cells. It is speculated that CD34 may also act as a scaffold for the binding of lineage-specific glycans, enabling stem cells to interact with lectins expressed by stromal cells or other components of the marrow. Additionally, CD34 is known to present carbohydrate ligands to selectins, further contributing to its involvement in cell adhesion processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P28906 (S32-T290)
-
Molecular Construction
-
N-term
-
CD34 (S32-T290)
Accession # P28906 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD34; CD34 Antigen; CD34 Molecule; CD34 Sialomucin; Hematopoietic Progenitor Cell Antigen CD34; Hematopoietic Progenital Cell Antigen CD34
-
AA Sequence
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
-
Predicted Molecular Mass
54 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)