CD34 Protein, Human (Biotinylated, HEK293, Fc)

CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD34 protein is a potential adhesion molecule that is thought to play a crucial role in early hematopoiesis by facilitating the attachment of stem cells to the extracellular matrix of the bone marrow or directly to stromal cells. It is speculated that CD34 may also act as a scaffold for the binding of lineage-specific glycans, enabling stem cells to interact with lectins expressed by stromal cells or other components of the marrow. Additionally, CD34 is known to present carbohydrate ligands to selectins, further contributing to its involvement in cell adhesion processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD34 (S32-T290)
      Accession # P28906
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    CD34; CD34 Antigen; CD34 Molecule; CD34 Sialomucin; Hematopoietic Progenitor Cell Antigen CD34; Hematopoietic Progenital Cell Antigen CD34

  • AA Sequence

    SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT

  • Predicted Molecular Mass

    54 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00