1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Rabbit (HEK293, His)

TNFR5/CD40, governs cellular responses to TNF, impacting inflammation, apoptosis, and immune processes. Its functions vary based on interactions with TNF ligands and other proteins in different cellular contexts. CD40 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD40 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD40 Protein, Rabbit (HEK293, His) is 173 a.a., with molecular weight of 28-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFR5/CD40, governs cellular responses to TNF, impacting inflammation, apoptosis, and immune processes. Its functions vary based on interactions with TNF ligands and other proteins in different cellular contexts. CD40 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD40 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD40 Protein, Rabbit (HEK293, His) is 173 a.a., with molecular weight of 28-35 kDa.

Background

TNFR5/CD40, also known as Tumor Necrosis Factor Receptor Superfamily Member 5, is a protein belonging to the tumor necrosis factor receptor superfamily. TNFR5 is involved in cellular responses to tumor necrosis factor (TNF) and contributes to various physiological processes, including inflammation, apoptosis, and immune regulation. The specific functions and signaling pathways mediated by TNFR5 depend on its interactions with TNF ligands and other associated proteins in different cellular contexts.

Biological Activity

Immobilized Rabbit CD40 His at 5 μg/mL (100 μL/well) can bind Human CD40 Ligand Fc with a linear range of 0.2-1 ng/mL.

Species

Rabbit

Source

HEK293

Tag

C-His

Accession

G1SPC6 (E77-R249)

Gene ID
Molecular Construction
N-term
CD40 (E77-R249)
Accession # G1SPC6
His
C-term
Protein Length

Partial

Synonyms
CD40; Bp50; CDW40; MGC9013; TNFRSF5; p50
AA Sequence

EPPTACRENQYQVNNQCCNLCPPGERLENECVDGTNTKCLPCSNGEFLDTWNRETRCHQHKYCDPNLGLQVQREGTSETDTTCTCQEGQHCISDACDSCAPHSSCPVGFGVRQKATEVSDTICEPCPDGFFSNVSSAVESCHPWTSCATHNLVELQAGTNKTDVRCGAQDRKR

Molecular Weight

28-35 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD40 Protein, Rabbit (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Rabbit (HEK293, His)
Cat. No.:
HY-P78612
Quantity:
MCE Japan Authorized Agent: