CD40 Protein, Rabbit (HEK293, His)
TNFR5/CD40, governs cellular responses to TNF, impacting inflammation, apoptosis, and immune processes. Its functions vary based on interactions with TNF ligands and other proteins in different cellular contexts. CD40 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD40 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD40 Protein, Rabbit (HEK293, His) is 173 a.a., with molecular weight of 28-35 kDa.
- Species: Rabbit
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TNFR5/CD40, governs cellular responses to TNF, impacting inflammation, apoptosis, and immune processes. Its functions vary based on interactions with TNF ligands and other proteins in different cellular contexts. CD40 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD40 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD40 Protein, Rabbit (HEK293, His) is 173 a.a., with molecular weight of 28-35 kDa.
TNFR5/CD40, also known as Tumor Necrosis Factor Receptor Superfamily Member 5, is a protein belonging to the tumor necrosis factor receptor superfamily. TNFR5 is involved in cellular responses to tumor necrosis factor (TNF) and contributes to various physiological processes, including inflammation, apoptosis, and immune regulation. The specific functions and signaling pathways mediated by TNFR5 depend on its interactions with TNF ligands and other associated proteins in different cellular contexts.
Technical Parameters
-
Species Rabbit
-
Source HEK293
-
Tag C-His
-
Accession
G1SPC6 (E77-R249)
-
Molecular Construction
-
N-term
-
CD40 (E77-R249)
Accession # G1SPC6 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
EPPTACRENQYQVNNQCCNLCPPGERLENECVDGTNTKCLPCSNGEFLDTWNRETRCHQHKYCDPNLGLQVQREGTSETDTTCTCQEGQHCISDACDSCAPHSSCPVGFGVRQKATEVSDTICEPCPDGFFSNVSSAVESCHPWTSCATHNLVELQAGTNKTDVRCGAQDRKR
-
Predicted Molecular Mass
20.9 kDa
-
Molecular Weight
Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
