CD8 alpha Protein, Rat (HEK293, Fc)
Based on 1 Customer Validation
CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The CD8 alpha protein, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions in responses against both external and internal threats. In T-cells, it functions primarily as a coreceptor for the MHC class I molecule:peptide complex, interacting simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs). This interaction facilitates the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK, in turn, initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately leading to lymphokine production, motility, adhesion, and the activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism, allowing the conjugation and lysis of multiple target cells. CD8A homodimer molecules also contribute to the survival and differentiation of activated lymphocytes into memory CD8 T-cells. CD8 alpha forms disulfide-linked heterodimers with CD8B at the cell surface and also homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Additionally, it interacts with the MHC class I HLA-A/B2M dimer and associates with LCK in a zinc-dependent manner.
Verified Bioactivity
Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 2.584 μg/mL, corresponding to a specific activity is 387.0 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
P07725 (Q27-Y189)
-
Molecular Construction
-
N-term
-
CD8 alpha (M1-Y189)
Accession # P07725 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD8A; Leu2 T-Lymphocyte Antigen; Prev. CD8; T-Cell Antigen Leu2; T-Cell Surface Glycoprotein CD8 Alpha Chain; T Cell Co-Receptor; T-Lymphocyte Differentiation Antigen T8/Leu-2; T8 T-Cell Antigen; CD8alpha; CD8a Antigen; P32; IMD116; CD8 Antigen, Alpha Pol
-
AA Sequence
QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)