CHRNA1 Protein, Mouse (His)
Based on 1 Customer Validation
The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His labeled tag.
The CHRNA1 protein, also known as the alpha-1 subunit of the acetylcholine receptor (AChR), plays a crucial role in mediating cellular responses upon acetylcholine binding. As a component of the AChR, it is part of a pentameric structure consisting of two alpha chains, a beta, a delta, and either a gamma (in immature muscle) or epsilon (in mature muscle) chain. Upon acetylcholine binding, the AChR undergoes an extensive conformational change across all subunits, resulting in the opening of an ion-conducting channel across the plasma membrane. This process is integral to the transmission of nerve signals at the neuromuscular junction. Additionally, the muscle heteropentamer, comprising alpha-1, beta-1, delta, and epsilon subunits, interacts with the alpha-conotoxin ImII, further highlighting the intricate molecular interactions involved in the functionality of CHRNA1 within the acetylcholine receptor complex.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P04756 (S21-L230)
-
Molecular Construction
-
N-term
-
6*His
-
CHRNA1 (S21-L230)
Accession # P04756 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CHRNA1; Nicotinic Acetylcholine Receptor Alpha Subunit; Prev. CHRNA; Nicotinic Cholinergic Receptor Alpha 1; Acetylcholine Receptor Subunit Alpha; ACHRD; Cholinergic Receptor, Nicotinic, Alpha Polypeptide 1 (Muscle); CMS1A; Acetylcholine Receptor, Nicotin
-
AA Sequence
SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm solution of 50 mM Tris-HCl, 300 mM NaCL, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
