CHRNA1 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The CHRNA1 protein, also known as the alpha-1 subunit of the acetylcholine receptor (AChR), plays a crucial role in mediating cellular responses upon acetylcholine binding. As a component of the AChR, it is part of a pentameric structure consisting of two alpha chains, a beta, a delta, and either a gamma (in immature muscle) or epsilon (in mature muscle) chain. Upon acetylcholine binding, the AChR undergoes an extensive conformational change across all subunits, resulting in the opening of an ion-conducting channel across the plasma membrane. This process is integral to the transmission of nerve signals at the neuromuscular junction. Additionally, the muscle heteropentamer, comprising alpha-1, beta-1, delta, and epsilon subunits, interacts with the alpha-conotoxin ImII, further highlighting the intricate molecular interactions involved in the functionality of CHRNA1 within the acetylcholine receptor complex.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CHRNA1 (S21-L230)
      Accession # P04756
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CHRNA1; Nicotinic Acetylcholine Receptor Alpha Subunit; Prev. CHRNA; Nicotinic Cholinergic Receptor Alpha 1; Acetylcholine Receptor Subunit Alpha; ACHRD; Cholinergic Receptor, Nicotinic, Alpha Polypeptide 1 (Muscle); CMS1A; Acetylcholine Receptor, Nicotin

  • AA Sequence

    SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm solution of 50 mM Tris-HCl, 300 mM NaCL, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00