CIB2 Protein, Human (His, solution)

Customer Review

Based on 1 Customer Validation

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His, solution) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His, solution) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag.

Background

CIB2 protein, a calcium- and integrin-binding protein, plays a crucial role in intracellular calcium homeostasis and functions as an auxiliary subunit of the sensory mechanoelectrical transduction (MET) channel in hair cells. Its essentiality for mechanoelectrical transduction currents in auditory hair cells underscores its significance in hearing. CIB2 regulates the function of hair cell mechanotransduction by influencing the distribution of transmembrane channel-like proteins TMC1 and TMC2 and by modulating the activity of MET channels in hair cells. Moreover, it is indispensable for maintaining the morphology and function of auditory hair cell stereocilia bundles and ensuring the survival of hair cells in the cochlea. Additionally, CIB2 plays a critical role in the maintenance and function of photoreceptor cells. Its involvement in intracellular calcium homeostasis is manifested through its ability to decrease ATP-induced calcium release. CIB2 exists as a monomer or homodimer and interacts with various proteins, including WHRN, MYO7A, ITGA2B, ITGA7, TMC1, and TMC2, with these interactions often being calcium and magnesium-dependent.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CIB2; DNA-Dependent Protein Kinase Catalytic Subunit-Interacting Protein 2; Prev. DFNB48; Deafness, Autosomal Recessive 48; Prev. USH1J; Kinase Interacting Protein 2; KIP2; Kinase-Interacting Protein 2; Calcium And Integrin-Binding Family Member 2; KIP 2;

  • AA Sequence

    MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

  • Predicted Molecular Mass

    21.6 kDa

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00