DCUN1D2 Protein, Human (His)

The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.

Background

DCUN1D2 protein plays a crucial role in the neddylation process of all cullins, facilitating the transfer of NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzymes to various cullin C-terminal domain-RBX complexes. This function is essential for regulating the activity of SCF (SKP1-CUL1-F-box protein)-type complexes. Through its DCUN1 domain, DCUN1D2 interacts with unneddylated cullins, including CUL1, CUL2, CUL3, CUL4A, CUL4B, and CUL5. The specificity of these interactions is influenced by the identity of the cullin, dictating the affinity of the interaction. DCUN1D2 may also engage with regulators or subunits of cullin-RING ligases, such as RBX1, RNF7, ELOB, and DDB1, with these interactions being mediated by cullins. Additionally, DCUN1D2 forms complexes with CAND1, inhibiting the neddylation of CUL3. Notably, the CAND1-cullin-DCNL complexes undergo neddylation only in the presence of a substrate adapter. Furthermore, DCUN1D2 interacts with the N-terminally acetylated forms of UBE2M and UBE2F, highlighting its involvement in intricate protein-protein interactions within the neddylation pathway.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • DCUN1D2 (M1-F259)
      Accession # Q6PH85-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    DCUN1D2; DCNL2; Prev. C13orf17; DCN1, Defective In Cullin Neddylation 1, Domain Containing 2; Defective In Cullin Neddylation Protein 1-Like Protein 2; Defective In Cullin Neddylation Protein 1-Like Protein; DCUN1 Domain-Containing Protein 2; Chromosome 1

  • AA Sequence

    MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00