DCUN1D2 Protein, Human (His)
Based on 1 Customer Validation
The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.
DCUN1D2 protein plays a crucial role in the neddylation process of all cullins, facilitating the transfer of NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzymes to various cullin C-terminal domain-RBX complexes. This function is essential for regulating the activity of SCF (SKP1-CUL1-F-box protein)-type complexes. Through its DCUN1 domain, DCUN1D2 interacts with unneddylated cullins, including CUL1, CUL2, CUL3, CUL4A, CUL4B, and CUL5. The specificity of these interactions is influenced by the identity of the cullin, dictating the affinity of the interaction. DCUN1D2 may also engage with regulators or subunits of cullin-RING ligases, such as RBX1, RNF7, ELOB, and DDB1, with these interactions being mediated by cullins. Additionally, DCUN1D2 forms complexes with CAND1, inhibiting the neddylation of CUL3. Notably, the CAND1-cullin-DCNL complexes undergo neddylation only in the presence of a substrate adapter. Furthermore, DCUN1D2 interacts with the N-terminally acetylated forms of UBE2M and UBE2F, highlighting its involvement in intricate protein-protein interactions within the neddylation pathway.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q6PH85-1 (M1-F259)
-
Gene ID55208 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
DCUN1D2 (M1-F259)
Accession # Q6PH85-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
DCUN1D2; DCNL2; Prev. C13orf17; DCN1, Defective In Cullin Neddylation 1, Domain Containing 2; Defective In Cullin Neddylation Protein 1-Like Protein 2; Defective In Cullin Neddylation Protein 1-Like Protein; DCUN1 Domain-Containing Protein 2; Chromosome 1
-
AA Sequence
MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 20% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)