1. Recombinant Proteins
  2. Others
  3. DLK-1 Protein, Human (HEK293, hFc)

The DLK-1 protein has been implicated in neuroendocrine differentiation, suggesting a role in the complex processes that control neuroendocrine cell development and specialization. As a monomer, the single molecular form of DLK-1 helps carry out its biological activity. DLK-1 Protein, Human (HEK293, hFc) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DLK-1 protein has been implicated in neuroendocrine differentiation, suggesting a role in the complex processes that control neuroendocrine cell development and specialization. As a monomer, the single molecular form of DLK-1 helps carry out its biological activity. DLK-1 Protein, Human (HEK293, hFc) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The DLK-1 protein appears to play a role in neuroendocrine differentiation, suggesting its involvement in the intricate processes associated with the development and specialization of neuroendocrine cells. Structurally, DLK-1 functions as a monomer, indicating that its singular molecular form is instrumental in carrying out its biological activities. Furthermore, DLK-1 interacts with SH3RF2, emphasizing potential molecular associations that may contribute to its functional roles. Further exploration into the specific mechanisms and downstream effects of DLK-1 in neuroendocrine differentiation could provide valuable insights into its significance and potential implications in neural development and cellular differentiation processes.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P80370-1 (A24-Q303)

Gene ID
Molecular Construction
N-term
DLK-1 (A24-Q303)
Accession # P80370-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
pG2; FA1; DLK; DLK1; DLK-1; Pref1; secredeltin; ZOG
AA Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Predicted Molecular Mass
56.6 kDa
Molecular Weight

Approximately 70-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DLK-1 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DLK-1 Protein, Human (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DLK-1 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P700856
Quantity:
MCE Japan Authorized Agent: