DLK-1 Protein, Human (HEK293, hFc)
The DLK-1 protein has been implicated in neuroendocrine differentiation, suggesting a role in the complex processes that control neuroendocrine cell development and specialization. As a monomer, the single molecular form of DLK-1 helps carry out its biological activity. DLK-1 Protein, Human (HEK293, hFc) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The DLK-1 protein has been implicated in neuroendocrine differentiation, suggesting a role in the complex processes that control neuroendocrine cell development and specialization. As a monomer, the single molecular form of DLK-1 helps carry out its biological activity. DLK-1 Protein, Human (HEK293, hFc) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The DLK-1 protein appears to play a role in neuroendocrine differentiation, suggesting its involvement in the intricate processes associated with the development and specialization of neuroendocrine cells. Structurally, DLK-1 functions as a monomer, indicating that its singular molecular form is instrumental in carrying out its biological activities. Furthermore, DLK-1 interacts with SH3RF2, emphasizing potential molecular associations that may contribute to its functional roles. Further exploration into the specific mechanisms and downstream effects of DLK-1 in neuroendocrine differentiation could provide valuable insights into its significance and potential implications in neural development and cellular differentiation processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P80370-1 (A24-Q303)
-
Molecular Construction
-
N-term
-
DLK-1 (A24-Q303)
Accession # P80370-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
DLK1; DLK; Delta Like Non-Canonical Notch Ligand 1; Delta-Like 1 Homolog (Drosophila); PG2; Delta-Like Homolog (Drosophila); Protein Delta Homolog 1; Preadipocyte Factor 1; Pref-1; Delta-Like 1 Homolog; Delta1; Fetal Antigen 1; FA1; Delta-Like 1; ZOG; Sec
-
AA Sequence
AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
-
Predicted Molecular Mass
56.6 kDa
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
