DMBT1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag.

Background

DMBT1 Protein emerges as a multifaceted candidate with potential tumor suppressor roles in brain, lung, esophageal, gastric, and colorectal cancers. Beyond its implications in cancer, DMBT1 is implicated in diverse biological processes, serving roles in the mucosal defense system, cellular immune defense, and epithelial differentiation. It acts as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including the gastrointestinal tract's epithelial cells. Furthermore, DMBT1 plays a role in liver regeneration and is a critical factor in the fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Its involvement in the terminal differentiation of columnar epithelial cells during early embryogenesis is noteworthy. Additionally, DMBT1 functions as a binding protein in saliva, potentially regulating taste sensation. It binds to the HIV-1 envelope protein, displaying a dual role in both inhibiting and facilitating viral transmission. The protein exhibits a broad calcium-dependent binding spectrum against Gram-positive and Gram-negative bacteria, suggesting a significant role in defense against bacterial pathogens. DMBT1's diverse interactions, including association with the actin cytoskeleton and involvement in its remodeling during regulated exocytosis, highlight its versatile functions in cellular processes. Its pH-dependent interaction with pancreatic zymogens suggests a potential role as a Golgi cargo receptor in the regulated secretory pathway of pancreatic acinar cells, further underlining the complexity and importance of DMBT1 in various physiological contexts.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized recombinant human Galectin-3 at 10 μg/mL (100 μl/well) can bind biotinylated DMBT1-His with a linear range of 0.06-1.0 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • DMBT1 (T20-S220)
      Accession # Q9UGM3/NP_004397.2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    DMBT1; Surfactant Pulmonary-Associated D-Binding Protein; Deleted In Malignant Brain Tumors 1; Deleted In Malignant Brain Tumors 1 Protein; Hensin; Salivary Scavenger And Agglutinin; GP340; Glycoprotein 340; Scavenger Receptor Cysteine-Rich Domain-Contain

  • AA Sequence

    TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRIS

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00