DMBT1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag.
Background
DMBT1 Protein emerges as a multifaceted candidate with potential tumor suppressor roles in brain, lung, esophageal, gastric, and colorectal cancers. Beyond its implications in cancer, DMBT1 is implicated in diverse biological processes, serving roles in the mucosal defense system, cellular immune defense, and epithelial differentiation. It acts as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including the gastrointestinal tract's epithelial cells. Furthermore, DMBT1 plays a role in liver regeneration and is a critical factor in the fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Its involvement in the terminal differentiation of columnar epithelial cells during early embryogenesis is noteworthy. Additionally, DMBT1 functions as a binding protein in saliva, potentially regulating taste sensation. It binds to the HIV-1 envelope protein, displaying a dual role in both inhibiting and facilitating viral transmission. The protein exhibits a broad calcium-dependent binding spectrum against Gram-positive and Gram-negative bacteria, suggesting a significant role in defense against bacterial pathogens. DMBT1's diverse interactions, including association with the actin cytoskeleton and involvement in its remodeling during regulated exocytosis, highlight its versatile functions in cellular processes. Its pH-dependent interaction with pancreatic zymogens suggests a potential role as a Golgi cargo receptor in the regulated secretory pathway of pancreatic acinar cells, further underlining the complexity and importance of DMBT1 in various physiological contexts.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human Galectin-3 at 10 μg/mL (100 μl/well) can bind biotinylated DMBT1-His with a linear range of 0.06-1.0 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9UGM3/NP_004397.2 (T20-S220)
-
Molecular Construction
-
N-term
-
DMBT1 (T20-S220)
Accession # Q9UGM3/NP_004397.2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
DMBT1; Surfactant Pulmonary-Associated D-Binding Protein; Deleted In Malignant Brain Tumors 1; Deleted In Malignant Brain Tumors 1 Protein; Hensin; Salivary Scavenger And Agglutinin; GP340; Glycoprotein 340; Scavenger Receptor Cysteine-Rich Domain-Contain
-
AA Sequence
TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRIS
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80 or 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)