1. Recombinant Proteins
  2. Receptor Proteins
  3. FOLR4 Protein, Mouse (HEK293, His)

FOLR4 is a receptor on the egg membrane that interacts with IZUMO1 and is essential for species-specific gamete recognition and fertilization. Although it is essential for fertilization, it is not sufficient by itself to achieve cell fusion. FOLR4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FOLR4 is a receptor on the egg membrane that interacts with IZUMO1 and is essential for species-specific gamete recognition and fertilization. Although it is essential for fertilization, it is not sufficient by itself to achieve cell fusion. FOLR4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.

Background

FOLR4, a receptor located at the oolemma (cell surface of oocytes), plays a pivotal role in species-specific gamete recognition and fertilization through its interaction with IZUMO1. This adhesion event is essential for successful fertilization, although it alone is not sufficient for cell fusion. Unlike its name might suggest, FOLR4 does not bind folate. Structurally, FOLR4 exists as a monomer and directly interacts with IZUMO1, forming a complex with a 1:1 stoichiometry. The IZUMO1:IZUMO1R/JUNO interaction mediated by FOLR4 is a crucial step in the intricate process of sperm and egg recognition, highlighting its significance in the fertilization cascade.

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

Q9EQF4-1 (G20-G222)

Gene ID
Molecular Construction
N-term
FOLR4 (G20-G222)
Accession # Q9EQF4-1
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Folate receptor 4; FR-delta; Izumo1r; Folbp3; Juno; FOLR4, LOC390243
AA Sequence

GDKLLSVCMNSKRHKQEPGPEDELYQECRPWEDNACCTRSTSWEAHLEEPLLFNFSMMHCGLLTPACRKHFIQAICFHECSPNLGPWIQPVVPNGQEEQRVWGVPLCQEDCEDWWRACHSSLTCKSNWLHGWDWSEEKKHCPAHEPCLPFSYHFPTPDDLCEKIWNNTFKASPERRNSGRCLQKWFEPTLSNPNVEVALHFAG

Predicted Molecular Mass
24.7 kDa
Molecular Weight

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FOLR4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FOLR4 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOLR4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77938
Quantity:
MCE Japan Authorized Agent: