FOLR4 Protein, Mouse (HEK293, His)

FOLR4 is a receptor on the egg membrane that interacts with IZUMO1 and is essential for species-specific gamete recognition and fertilization. Although it is essential for fertilization, it is not sufficient by itself to achieve cell fusion. FOLR4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.

FOLR4, a receptor located at the oolemma (cell surface of oocytes), plays a pivotal role in species-specific gamete recognition and fertilization through its interaction with IZUMO1. This adhesion event is essential for successful fertilization, although it alone is not sufficient for cell fusion. Unlike its name might suggest, FOLR4 does not bind folate. Structurally, FOLR4 exists as a monomer and directly interacts with IZUMO1, forming a complex with a 1:1 stoichiometry. The IZUMO1:IZUMO1R/JUNO interaction mediated by FOLR4 is a crucial step in the intricate process of sperm and egg recognition, highlighting its significance in the fertilization cascade.

Mouse

HEK293

C-8*His

Q9EQF4-1 (G20-G222)

64931  [NCBI]

Full Length of Mature Protein

GDKLLSVCMNSKRHKQEPGPEDELYQECRPWEDNACCTRSTSWEAHLEEPLLFNFSMMHCGLLTPACRKHFIQAICFHECSPNLGPWIQPVVPNGQEEQRVWGVPLCQEDCEDWWRACHSSLTCKSNWLHGWDWSEEKKHCPAHEPCLPFSYHFPTPDDLCEKIWNNTFKASPERRNSGRCLQKWFEPTLSNPNVEVALHFAG

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.