FOLR4 Protein, Mouse (HEK293, His)
FOLR4 is a receptor on the egg membrane that interacts with IZUMO1 and is essential for species-specific gamete recognition and fertilization. Although it is essential for fertilization, it is not sufficient by itself to achieve cell fusion. FOLR4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOLR4 is a receptor on the egg membrane that interacts with IZUMO1 and is essential for species-specific gamete recognition and fertilization. Although it is essential for fertilization, it is not sufficient by itself to achieve cell fusion. FOLR4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.
Background
FOLR4, a receptor located at the oolemma (cell surface of oocytes), plays a pivotal role in species-specific gamete recognition and fertilization through its interaction with IZUMO1. This adhesion event is essential for successful fertilization, although it alone is not sufficient for cell fusion. Unlike its name might suggest, FOLR4 does not bind folate. Structurally, FOLR4 exists as a monomer and directly interacts with IZUMO1, forming a complex with a 1:1 stoichiometry. The IZUMO1:IZUMO1R/JUNO interaction mediated by FOLR4 is a crucial step in the intricate process of sperm and egg recognition, highlighting its significance in the fertilization cascade.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9EQF4-1 (G20-G222)
-
Molecular Construction
-
N-term
-
FOLR4 (G20-G222)
Accession # Q9EQF4-1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IZUMO1R; Folate Receptor Delta; Prev. FOLR4; Folate Receptor 4 (Delta) Homolog (Mouse); JUNO; Folate Receptor 4 (Delta) Homolog; Folbp3; IZUMO1 Receptor, JUNO, FR-Delta; Folate Receptor 4, Delta (Putative); Probable Folate Receptor Delta; Sperm-Egg Fusion
-
AA Sequence
GDKLLSVCMNSKRHKQEPGPEDELYQECRPWEDNACCTRSTSWEAHLEEPLLFNFSMMHCGLLTPACRKHFIQAICFHECSPNLGPWIQPVVPNGQEEQRVWGVPLCQEDCEDWWRACHSSLTCKSNWLHGWDWSEEKKHCPAHEPCLPFSYHFPTPDDLCEKIWNNTFKASPERRNSGRCLQKWFEPTLSNPNVEVALHFAG
-
Predicted Molecular Mass
24.7 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
