1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Mouse (CHO)

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
250 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE G-CSF Protein, Mouse (CHO)

In Vivo Efficacy Study
Histological Imaging/Staining

    G-CSF Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol.2024 May 23:135:112322.  [Abstract]

    Schematic diagram of experimental protocol for evaluating CSF3 role in exacerbating BLM induced pulmonary fibrosis in mice. 13 days-post BLM injection, mice were administrated 0.35 mg/kg G-CSF protein twice per day for 2 days to evaluate.

    G-CSF Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol.2024 May 23:135:112322.  [Abstract]

    Increased proinflammatory (Th1) related cytokines after G-CSF (0.35 mg/kg, twice per day, 2 days) administration in PF mice.

    G-CSF Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol.2024 May 23:135:112322.  [Abstract]

    The representative H&E and Masson staining of lung section was shown for 5 groups.
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    • Referencias

    Descripciòn

    G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

    Background

    Granulocyte Colony Stimulating Factor (G-CSF) is a cytokine that normally acts in the bone marrow microenvironment to stimulate blood cell formation. It selectively promotes growth and maturation of neutrophil progenitor cells. Granulocyte Colony Stimulating Factor receptors are present on precursor cells in the bone marrow. By binding to these receptors, Granulocyte Colony Stimulating Factor initiates proliferation and differentiation into mature granulocytes, and also stimulates bone marrow cell release into the circulation. In addition to growth promotion, Granulocyte Colony Stimulating Factor also effects phagocytosis, motility, bactericidal activity and surface molecule expression of neutrophils and monocytes[1][2]. G-CSF production is induced by several inflammatory stimuli that become rapidly elevated during infection such as interleukin-1β (IL-1β), tumor necrosis factor-alpha (TNFα) and lipopolysaccaride (LPS). Therefore, pathogen-mediated activation of host pattern recognition receptors via LPS, and the host cytokine response to infection, serve to induce circulating levels of G-CSF[3].

    Actividad biológica

    The ED50 is 10-60 pg/mL as measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells.

    • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 33.43 pg/mL, corresponding to a specific activity is 2.99×107 units/mg.
    Species

    Mouse

    Source

    CHO

    Tag

    Tag Free

    Accession

    P09920 (V31-A208)

    Gene ID
    Molecular Construction
    N-term
    G-CSF (V31-A208)
    Accession # P09920
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rMuG-CSF; CSF-3; MGI-1G; Pluripoietin; Molgramostin; Sargramostim
    AA Sequence

    VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

    Predicted Molecular Mass
    19 kDa
    Peso molecular

    Approximately 22-24 kDa, based on SDS-PAGE under reducing conditions.

    Glycosylation
    Yes
    Pureza
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación
    Referencias

    G-CSF Protein, Mouse (CHO) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    G-CSF Protein, Mouse (CHO)

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    G-CSF Protein, Mouse (CHO)
    Cat. No.:
    HY-P7068
    Cantidad:
    MCE Japan Authorized Agent: