Copy Link Print Information

G-CSF Protein, Mouse (CHO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • G-CSF Protein, Mouse (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Background

Granulocyte Colony Stimulating Factor (G-CSF) is a cytokine that normally acts in the bone marrow microenvironment to stimulate blood cell formation. It selectively promotes growth and maturation of neutrophil progenitor cells. Granulocyte Colony Stimulating Factor receptors are present on precursor cells in the bone marrow. By binding to these receptors, Granulocyte Colony Stimulating Factor initiates proliferation and differentiation into mature granulocytes, and also stimulates bone marrow cell release into the circulation. In addition to growth promotion, Granulocyte Colony Stimulating Factor also effects phagocytosis, motility, bactericidal activity and surface molecule expression of neutrophils and monocytes[1][2]. G-CSF production is induced by several inflammatory stimuli that become rapidly elevated during infection such as interleukin-1β (IL-1β), tumor necrosis factor-alpha (TNFα) and lipopolysaccaride (LPS). Therefore, pathogen-mediated activation of host pattern recognition receptors via LPS, and the host cytokine response to infection, serve to induce circulating levels of G-CSF[3].

Verified Bioactivity

The ED50 is 10-60 pg/mL as measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession

    P09920 (V31-A208)

  • Gene ID
    12985  [NCBI]
  • Molecular Construction
    • N-term
    • G-CSF (V31-A208)
      Accession # P09920
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CSF3; Filgrastim; Prev. C17orf33; MGC45931; Prev. GCSF; Colony Stimulating Factor 3 Nirs Variant 1; Prev. G-CSF; Granulocyte Colony Stimulating Factor; Granulocyte Colony-Stimulating Factor; Granulocyte-Colony Stimulating Factor; Pluripoietin; Chromosome

  • AA Sequence

    VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

  • Predicted Molecular Mass

    19 kDa

  • Molecular Weight

    Approximately 22-24 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78(11):2791-808. [Content Brief]

[2]. Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond). 2014 Feb;75(2):C29-32. [Content Brief]

[3]. Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42(3):277-88. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 33.43 pg/mL, corresponding to a specific activity is 2.99×107 units/mg.

  • 1/16

    G-CSF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Jun 30:135:112322. [Abstract]

    Customer Validation
     Schematic diagram of experimental protocol for evaluating CSF3 role in exacerbating BLM induced pulmonary fibrosis in mice. 13 days-post BLM injection, mice were administrated 0.35 mg/kg G-CSF protein twice per day for 2 days to evaluate.

  • 1/16

    G-CSF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Jun 30:135:112322. [Abstract]

    Customer Validation
     Increased proinflammatory (Th1) related cytokines after G-CSF (0.35 mg/kg, twice per day, 2 days) administration in PF mice.

  • 1/16

    G-CSF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Jun 30:135:112322. [Abstract]

    Customer Validation
     The representative H&E and Masson staining of lung section was shown for 5 groups.

  • G-CSF Protein, Mouse (CHO) Product Image
    1/16
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • Experimental Validation Results for G-CSF Protein, Mouse (CHO)
  • G-CSF Protein, Mouse (CHO) Product Image