Copy Link Print Information

I-309/CCL1 Protein, Human (CHO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

I-309/CCL1 Protein, Human (CHO) is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human (CHO) is a recombinant human CCL1 (K24-K96) expressed by CHO.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for I-309/CCL1 Protein, Human (CHO)
  • Experimental Validation Results for I-309/CCL1 Protein, Human (CHO)
  • I-309/CCL1 Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

I-309/CCL1 Protein, Human (CHO) is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human (CHO) is a recombinant human CCL1 (K24-K96) expressed by CHO[1].

Background

CCL1 is a small glycoprotein belonging to the CC chemokine family with a molecular weight of approximately 15-16 kDa, known as small inducible cytokine I-309 in humans and TCA-3 in mice. CCL1 is secreted by activated monocytes, macrophages, T lymphocytes and endothelial cells and is chemotactic for monocytes but not for neutrophils[1].    CCL1 can be activated by interaction with the cell surface chemokine receptor CCR8, which induces Ca2+ influx, stimulates transient increases in cytoplasmic free calcium concentration in monocytes, and inhibits apoptosis in thymocyte lines via the RAS/MAPK pathway. Among others, CCR8 is constitutively expressed in monocytes, macrophages, Th2 and regulatory T lymphocytes and is the sole receptor for the human CCL1 and for the viral chemokine, vCCL1 (viral macrophage inflammatory protein 1). CCR8 has been shown to be associated with phagocytic macrophages and activated microglia in MS lesions and is directly related to demyelinating activity[2].     CCL1 is involved in inflammatory processes through leukocyte recruitment and can play a key role in angiogenesis and other viral and neoplastic processes. A number of single nucleotide polymorphisms (SNPs) in the CCL1 gene have been associated with the progression of chronic obstructive pulmonary disease (COPD). In parallel, CCL1 plays a role in various CNS functions and diseases and may be associated with neuroinflammatory disorders[3].

In Vitro

CCL1 (100 ng/mL, 3h) stimulates a 14-fold increase in human aortic smooth muscle cells (VSMCs) migration and induces VSMC chemotaxis. Also, it stimulates VSMC secretion of pro - MMP2 and induces MMP-2 mRNA[4].

Verified Bioactivity

1.The ED50 is <1 μg/mL as measured by CHO-K1/Gα15/hCCR8 cells (human Gα15 and human CCR8 stably expressed in CHO-K1 cells).
2.Determined by its ability to chemoattract THP-1 cells. The ED50 for this effect is <30 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by its ability to chemoattract THP-1 cells. The ED50 for this effect is 22 ng/mL, corresponding to a specific activity is 4.545×104 U/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P22362 (K24-K96)

  • Gene ID
    6346  [NCBI]
  • Molecular Construction
    • N-term
    • CCL1 (K24-K96)
      Accession # P22362
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL1; SISe; Prev. SCYA1; Chemokine (C-C Motif) Ligand 1; T Lymphocyte-Secreted Protein I-309; Inflammatory Cytokine I-309; I-309; C-C Motif Chemokine 1; TCA3; Small-Inducible Cytokine A1; P500; C-C Motif Chemokine Ligand 1; Small Inducible Cytokine A1 (I-

  • AA Sequence

    KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

  • Predicted Molecular Mass

    8.5 kDa

  • Molecular Weight

    Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. M D Miller, et al. The human cytokine I-309 is a monocyte chemoattractant. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2950-4. [Content Brief]

[2]. Miller MD, et al. The human cytokine I-309 is a monocyte chemoattractant. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2950-4. [Content Brief]

[3]. A Zingoni, et al. The chemokine receptor CCR8 is preferentially expressed in Th2 but not Th1 cells. J Immunol. 1998 Jul 15;161(2):547-51. [Content Brief]

[4]. Roos RS, et al. Identification of CCR8, the receptor for the human CC chemokine I-309. J Biol Chem. 1997 Jul 11;272(28):17251-4. [Content Brief]

[5]. Gültekin Tamgüney, et al. Autocrine stimulation of rhadinovirus-transformed T cells by the chemokine CCL1/I-309. Oncogene. 2004 Nov 4;23(52):8475-85. [Content Brief]

[6]. Nasreen S Haque, et al. Chemokine receptor-8 (CCR8) mediates human vascular smooth muscle cell chemotaxis and metalloproteinase-2 secretion. Blood. 2004 Feb 15;103(4):1296-304. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Determined by its ability to chemoattract THP-1 cells. The ED50 for this effect is 22 ng/mL, corresponding to a specific activity is 4.545×104 U/mg.

  • I-309/CCL1 Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for I-309/CCL1 Protein, Human (CHO)
  • Experimental Validation Results for I-309/CCL1 Protein, Human (CHO)
  • I-309/CCL1 Protein, Human (CHO) Product Image