ICOS Protein, Mouse (Biotinylated, HEK293, Fc-Avi)
ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
Background
The ICOS protein enhances all fundamental T-cell responses to foreign antigens, including proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and providing effective help for antibody secretion by B-cells. It is essential for facilitating efficient communication between T and B-cells and for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it superinduces the synthesis of interleukin-10. Additionally, it prevents apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. ICOS exists as a homodimer, connected by disulfide bonds.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
Q9WVS0 (E21-L144)
-
Molecular Construction
-
N-term
-
ICOS (E21-L144)
Accession # Q9WVS -
hFc-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
ICOS; CD278; Inducible T Cell Costimulator; Inducible T-Cell Co-Stimulator; Activation-Inducible Lymphocyte Immunomediatory Molecule; Inducible Costimulator; Inducible T-Cell Costimulator; CD278 Antigen; AILIM; CVID1
-
AA Sequence
EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL
-
Predicted Molecular Mass
42.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)