IFN-gamma Protein, Canine

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, and plays a key role in activating antibacterial, antiviral, and antitumor responses. Through the JAK-STAT pathway, its interaction with the receptor IFNGR1 triggers gene regulation. IFN-gamma Protein, Canine is the recombinant canine-derived IFN-gamma protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, and plays a key role in activating antibacterial, antiviral, and antitumor responses. Through the JAK-STAT pathway, its interaction with the receptor IFNGR1 triggers gene regulation. IFN-gamma Protein, Canine is the recombinant canine-derived IFN-gamma protein, expressed by E. coli , with tag free.

Background

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells like T-cells and NK cells, plays pivotal roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling pathway involves the JAK-STAT pathway upon interaction with its receptor, IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain undergoes conformational changes, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1. This cascade leads to STAT1 activation, nuclear translocation, and subsequent transcription of IFN-gamma-regulated genes, many of which are transcription factors like IRF1, capable of driving a subsequent wave of transcription. IFN-gamma contributes to the class I antigen presentation pathway by inducing the replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby enhancing the quantity, quality, and repertoire of peptides for class I MHC loading. It also increases the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Furthermore, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Beyond its direct immune functions, IFN-gamma participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions, influencing their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization, orchestrating its diverse and critical functions in immune responses and hematopoiesis.

Verified Bioactivity

1.Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is 0.02-0.1 ng/mL.
2.Measured by its ability to inhibit the proliferation of MDCK cells. The ED50 for this effect is < 0.1 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is 0.02271 ng/mL, corresponding to a specific activity is 4.40×107 Unit/mg.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IFN-gamma (Q24-K166)
      Accession # P42161
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00