IL-21 Protein, Canine

IL-21 is a potent immunoregulatory cytokine that orchestrates the delicate interplay between innate and adaptive immunity. It drives the production of IgG(1) and IgG(3) in B cells, which are critical for humoral immune responses, and plays a key role in T follicular helper (Tfh) cell generation and germinal center formation. IL-21 Protein, Canine is the recombinant canine-derived IL-21 protein, expressed by E. coli , with tag free.

IL-21, a cytokine endowed with potent immunoregulatory activity, emerges as a central orchestrator in the delicate interplay between innate and adaptive immunity. Exhibiting its versatile influence, IL-21 stimulates the production of IgG(1) and IgG(3) in B-cells, underscoring its crucial role in shaping humoral immune responses. The cytokine is intricately involved in the generation and maintenance of T follicular helper (Tfh) cells and the dynamic formation of germinal centers. Collaborating synergistically with IL6, IL-21 assumes a pivotal role in steering the early development of Tfh cells, proving indispensable for mounting an effective antibody response during acute viral infections. Extending its regulatory reach, IL-21 may contribute to the proliferation and maturation of natural killer (NK) cells, working in concert with IL15. Furthermore, IL-21 exerts a regulatory hand in controlling the proliferation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it stimulates the production of interferon-gamma in both T-cells and NK cells, adding layers to its intricate regulatory functions. Notably, during T-cell-mediated immune responses, IL-21 emerges as a potential inhibitor, curbing the activation and maturation of dendritic cells, further highlighting its nuanced role in immune modulation.

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells.The ED₅₀ for this effect is typically 0.4-7.767 ng/mL.

• 
  Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED₅₀ for this effect is 7.767 ng/mL, corresponding to a specific activity is 1.287×10⁵ U/mg.

Canine

E. coli

Tag Free

Q6L7I9 (H18-S146)

442935  [NCBI]

Full Length of Mature Protein

HKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.