1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-21
  5. IL-21 Protein, Canine

IL-21 is a potent immunoregulatory cytokine that orchestrates the delicate interplay between innate and adaptive immunity. It drives the production of IgG(1) and IgG(3) in B cells, which are critical for humoral immune responses, and plays a key role in T follicular helper (Tfh) cell generation and germinal center formation. IL-21 Protein, Canine is the recombinant canine-derived IL-21 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-21 is a potent immunoregulatory cytokine that orchestrates the delicate interplay between innate and adaptive immunity. It drives the production of IgG(1) and IgG(3) in B cells, which are critical for humoral immune responses, and plays a key role in T follicular helper (Tfh) cell generation and germinal center formation. IL-21 Protein, Canine is the recombinant canine-derived IL-21 protein, expressed by E. coli , with tag free.

Background

IL-21, a cytokine endowed with potent immunoregulatory activity, emerges as a central orchestrator in the delicate interplay between innate and adaptive immunity. Exhibiting its versatile influence, IL-21 stimulates the production of IgG(1) and IgG(3) in B-cells, underscoring its crucial role in shaping humoral immune responses. The cytokine is intricately involved in the generation and maintenance of T follicular helper (Tfh) cells and the dynamic formation of germinal centers. Collaborating synergistically with IL6, IL-21 assumes a pivotal role in steering the early development of Tfh cells, proving indispensable for mounting an effective antibody response during acute viral infections. Extending its regulatory reach, IL-21 may contribute to the proliferation and maturation of natural killer (NK) cells, working in concert with IL15. Furthermore, IL-21 exerts a regulatory hand in controlling the proliferation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it stimulates the production of interferon-gamma in both T-cells and NK cells, adding layers to its intricate regulatory functions. Notably, during T-cell-mediated immune responses, IL-21 emerges as a potential inhibitor, curbing the activation and maturation of dendritic cells, further highlighting its nuanced role in immune modulation.

Biological Activity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells.The ED50 for this effect is typically 0.4-7.767 ng/mL.

  • Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is 7.767 ng/mL, corresponding to a specific activity is 1.287×105 U/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

Q6L7I9 (H18-S146)

Gene ID
Molecular Construction
N-term
IL-21 (H18-S146)
Accession # Q6L7I9
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-21; Il21; Za11
AA Sequence

HKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS

Predicted Molecular Mass
15 kDa
Molecular Weight

Approximately 15kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-21 Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-21 Protein, Canine

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21 Protein, Canine
Cat. No.:
HY-P74819
Quantity:
MCE Japan Authorized Agent: