IL-21 Protein, Canine

Customer Review

Based on 1 Customer Validation

IL-21 is a potent immunoregulatory cytokine that orchestrates the delicate interplay between innate and adaptive immunity. It drives the production of IgG(1) and IgG(3) in B cells, which are critical for humoral immune responses, and plays a key role in T follicular helper (Tfh) cell generation and germinal center formation. IL-21 Protein, Canine is the recombinant canine-derived IL-21 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-21 is a potent immunoregulatory cytokine that orchestrates the delicate interplay between innate and adaptive immunity. It drives the production of IgG(1) and IgG(3) in B cells, which are critical for humoral immune responses, and plays a key role in T follicular helper (Tfh) cell generation and germinal center formation. IL-21 Protein, Canine is the recombinant canine-derived IL-21 protein, expressed by E. coli , with tag free.

Background

IL-21, a cytokine endowed with potent immunoregulatory activity, emerges as a central orchestrator in the delicate interplay between innate and adaptive immunity. Exhibiting its versatile influence, IL-21 stimulates the production of IgG(1) and IgG(3) in B-cells, underscoring its crucial role in shaping humoral immune responses. The cytokine is intricately involved in the generation and maintenance of T follicular helper (Tfh) cells and the dynamic formation of germinal centers. Collaborating synergistically with IL6, IL-21 assumes a pivotal role in steering the early development of Tfh cells, proving indispensable for mounting an effective antibody response during acute viral infections. Extending its regulatory reach, IL-21 may contribute to the proliferation and maturation of natural killer (NK) cells, working in concert with IL15. Furthermore, IL-21 exerts a regulatory hand in controlling the proliferation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it stimulates the production of interferon-gamma in both T-cells and NK cells, adding layers to its intricate regulatory functions. Notably, during T-cell-mediated immune responses, IL-21 emerges as a potential inhibitor, curbing the activation and maturation of dendritic cells, further highlighting its nuanced role in immune modulation.

Verified Bioactivity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells.The ED50 for this effect is typically 0.4-7.767 ng/mL.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-21 (H18-S146)
      Accession # Q6L7I9
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL21; Interleukin-21; Interleukin 21; Interleukin; IL-21; CVID11; Za11

  • AA Sequence

    HKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS

  • Predicted Molecular Mass

    15 kDa

  • Molecular Weight

    Approximately 15kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00