1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-3 Protein, Canine

IL-3 Protein, Canine

Cat. No.: HY-P7216
Handling Instructions

IL-3 Protein, Canine is a hemopoietic growth factor involved in the survival, proliferation and differentiation of multipotent hemopoietic cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $210 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

IL-3 Protein, Canine Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Canine

Source

E. coli

Tag

Tag Free

Accession

Q9BDX4 (R24-P143)

Gene ID

481497

Synonyms
rCaIL-3; Mast cell growth factor; MCGF; Hematopoietic growth factor
AA Sequence

RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP

Molecular Weight

Approximately 14.0 kDa

Biological Activity
The ED50 is <0.2 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >5.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-3 (IL-3) is a multipotent hematopoietic growth factor produced by activated T cells, monocytes/macrophages and stroma cells. Addition of IL-3 to the culture medium induces proliferation, maturation and probably self-renewal of pluripotent hematopoietic stem cells and cells of myeloid, erythroid and megakaryocytic lineages[1]. IL-3 preferentially supports the proliferation and differentiation of progenitors at early stages of hematopoietic development. In addition, IL-3 exerts a wide spectrum of biological activities on various target cell populations, including T cells, B cells, eosinophils, basophils and monocytes[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Canine
Cat. No.:
HY-P7216
Quantity:
MCE Japan Authorized Agent: