Kallikrein-2 Protein, Human (Active, Biotinylated, HEK293, His-Avi)
The Kallikrein-2 protein is a member of the glandular kallikrein family and is critical in the enzymatic process as it selectively cleaves the Met-Lys and Arg-Ser bonds in kininogen, thereby releasing Lys-bradykinin . This proteolytic activity contributes to the production of bradykinin, a bioactive peptide with multiple roles in regulating blood pressure, inflammation, and vascular permeability.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
The Kallikrein-2 protein is a member of the glandular kallikrein family and is critical in the enzymatic process as it selectively cleaves the Met-Lys and Arg-Ser bonds in kininogen, thereby releasing Lys-bradykinin . This proteolytic activity contributes to the production of bradykinin, a bioactive peptide with multiple roles in regulating blood pressure, inflammation, and vascular permeability.
Background
Kallikrein-2 is a member of the glandular kallikrein family, exhibiting enzymatic activity by cleaving Met-Lys and Arg-Ser bonds in kininogen, resulting in the release of Lys-bradykinin. As part of the kinin-kallikrein system, Kallikrein-2 contributes to the generation of bradykinin, a potent vasoactive peptide involved in the regulation of blood pressure, inflammation, and vascular permeability. By specifically cleaving these bonds in kininogen, Kallikrein-2 plays a crucial role in the controlled release of Lys-bradykinin, influencing downstream physiological processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P20151-1 (I25-P261)
-
Gene ID3817
-
Molecular Construction
-
N-term
-
Kallikrein-2 (I25-P261)
Accession # P20151-1 -
His-Avi
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
KLK2; Kallikrein 2 Isoform 5 Preproprotein; Kallikrein Related Peptidase 2; Kallikrein 2 Isoform 6 Preproprotein; HGK-1; Glandular Kallikrein 2; Kallikrein 2, Prostatic; Kallikrein-2 Isoform 5; Glandular Kallikrein-1; Kallikrein-2 Isoform 6; Tissue Kallikrein-2; Kallikrein-2 Isoform 8; Kallikrein-2; Kallikrein-2 Isoform 7; KLK2A2; Kallikrein-2 Isoform 4; HK2; Kallikrein A3; Kallikrein 2, Prostatic, Isoform CRA_a
-
AA Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
-
Predicted Molecular Mass
29.7 kDa
-
Molecular Weight
Approximately 32-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
