KIR2DL1 Protein, Human (HEK293, His-Avi)

KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

KIR2DL1, located on natural killer (NK) cells, acts as a receptor for specific HLA-C alleles, including w4 and w6, ultimately inhibiting NK cell activity to prevent cell lysis. This regulatory role is facilitated through interactions with ARRB2. Moreover, KIR2DL1 engages with PTPN6 and PTPN11, with the interaction being enhanced by ARRB2, further emphasizing its involvement in intricate signaling networks that modulate NK cell function.

Human

HEK293

C-Avi;C-8*His

P43626-1 (H22-R242)

3802  [NCBI]

Extracellular Domain

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR

Approximately 40-52 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.