KIR2DL1 Protein, Human (HEK293, His-Avi)
KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
KIR2DL1, located on natural killer (NK) cells, acts as a receptor for specific HLA-C alleles, including w4 and w6, ultimately inhibiting NK cell activity to prevent cell lysis. This regulatory role is facilitated through interactions with ARRB2. Moreover, KIR2DL1 engages with PTPN6 and PTPN11, with the interaction being enhanced by ARRB2, further emphasizing its involvement in intricate signaling networks that modulate NK cell function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P43626-1 (H22-R242)
-
Molecular Construction
-
N-term
-
KIR2DL1 (H22-R242)
Accession # P43626-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KIR2DL1; Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 1; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 1; P58 Killer Cell Inhibitory Receptor KIR-K64; CD158A; Killer Cell Immunoglobulin-Li
-
AA Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR
-
Predicted Molecular Mass
27.1 kDa
-
Molecular Weight
Approximately 40-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)