KIR2DL1 Protein, Human (HEK293, His-Avi)

KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR2DL1, located on natural killer (NK) cells, acts as a receptor for specific HLA-C alleles, including w4 and w6, ultimately inhibiting NK cell activity to prevent cell lysis. This regulatory role is facilitated through interactions with ARRB2. Moreover, KIR2DL1 engages with PTPN6 and PTPN11, with the interaction being enhanced by ARRB2, further emphasizing its involvement in intricate signaling networks that modulate NK cell function.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • KIR2DL1 (H22-R242)
      Accession # P43626-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KIR2DL1; Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 1; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 1; P58 Killer Cell Inhibitory Receptor KIR-K64; CD158A; Killer Cell Immunoglobulin-Li

  • AA Sequence

    HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR

  • Predicted Molecular Mass

    27.1 kDa

  • Molecular Weight

    Approximately 40-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00