LILRB2/CD85d/ILT-4 Protein, Human (HEK293, mFc)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, mFc) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, mFc) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The LILRB2/CD85d/ILT-4 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. It plays a crucial role in immune response down-regulation and the establishment of tolerance. Specifically, it recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, leading to the differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, crucial for maintaining maternal-fetal tolerance. LILRB2 competes with CD8A for binding to class I MHC antigens and inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. Moreover, it interacts with PTPN6 when phosphorylated and binds to FCGR1A. The direct interactions with peptide-bound HLA-G-B2M and HLA-F-B2M further highlight its involvement in immune modulation.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LILRB2 (Q22-R457)
      Accession # Q8N423
    • mFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    LILRB2; Monocyte/Macrophage Immunoglobulin-Like Receptor 10; Leukocyte Immunoglobulin Like Receptor B2; CD85 Antigen-Like Family Member D; MIR-10; Myeloid Inhibitory Receptor 10; LIR-2; Leucocyte Ig-Like Receptor B2; MIR10; ILT-4; ILT4; Leukocyte Immunogl

  • AA Sequence

    QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGR

  • Predicted Molecular Mass

    73.6 kDa

  • Molecular Weight

    Approximately 80-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00