MFAP3 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
MFAP3 (microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cell structure. As a component of elastin-related microfibrils, it is essential in providing structural integrity and elasticity to various tissues in the body. MFAP3 Protein, Human (HEK293, Fc) is the recombinant human-derived MFAP3 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MFAP3 (microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cell structure. As a component of elastin-related microfibrils, it is essential in providing structural integrity and elasticity to various tissues in the body. MFAP3 Protein, Human (HEK293, Fc) is the recombinant human-derived MFAP3 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
MFAP3 (Microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cellular architecture. It functions as a component of elastin-associated microfibrils, which are essential for providing structural integrity and elasticity to various tissues in the body. By being involved in the formation and organization of these microfibrils, MFAP3 contributes to the overall stability and functionality of tissues that require elasticity, such as blood vessels, skin, and lungs. Understanding the role of MFAP3 can provide insights into the mechanisms underlying tissue development, maintenance, and potential diseases related to abnormalities in cellular architecture.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P55082-1 (A19-M147)
-
Molecular Construction
-
N-term
-
MFAP3 (A19-M147)
Accession # P55082-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MFAP3; Microfibril-Associated Glycoprotein 3; Microfibril Associated Protein 3; Microfibrillar Associated Protein 3
-
AA Sequence
AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDM
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
