MFG-E8 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.
Background
MFG-E8 (Milk Fat Globule-Epidermal Growth Factor 8) is a versatile protein that contributes significantly to the phagocytic removal of apoptotic cells in various tissues. Serving as a specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors, MFG-E8 facilitates the recognition and clearance of apoptotic cells by phagocytes. Additionally, it exhibits binding capabilities to phosphatidylserine-enriched cell surfaces independently of receptors. With its role as a zona pellucida-binding protein, MFG-E8 may contribute to gamete interactions (By similarity). Notably, MFG-E8 is crucial for maintaining intestinal epithelial homeostasis and promoting mucosal healing, highlighting its significance in gastrointestinal health. Furthermore, MFG-E8 plays a key role in promoting VEGF-dependent neovascularization, emphasizing its involvement in angiogenesis and tissue repair processes.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of SVEC4-10 mouse vascular endothelial cells. The ED50 for this effect is 10-50 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
P21956 (A23-C463)
-
Molecular Construction
-
N-term
-
His
-
MFG-E8 (A23-C463)
Accession # P21956 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MFGE8; HP47; Prev. SPAG10; Breast Epithelial Antigen BA46; MFG-E8; Sperm Associated Antigen 10; SED1; Sperm Surface Protein HP47; Lactadherin; HMFG; HsT19888; MFGM; OAcGD3S; O-Acetyl Disialoganglioside Synthase; EDIL1; Milk Fat Globule-EGF Factor 8; BA46;
-
AA Sequence
ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)