MPZL3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The MPZL3 protein is an important mediator of homogeneous cell-to-cell adhesion and promotes important interactions between cells. Its role in establishing connections emphasizes its importance in cellular cohesion, maintaining structural integrity, and facilitating communication between adjacent cells. MPZL3 Protein, Human (HEK293, His) is the recombinant human-derived MPZL3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MPZL3 protein is an important mediator of homogeneous cell-to-cell adhesion and promotes important interactions between cells. Its role in establishing connections emphasizes its importance in cellular cohesion, maintaining structural integrity, and facilitating communication between adjacent cells. MPZL3 Protein, Human (HEK293, His) is the recombinant human-derived MPZL3 protein, expressed by HEK293 , with C-His labeled tag.
Background
MPZL3 Protein serves as a crucial mediator of homophilic cell-cell adhesion, facilitating essential interactions between cells. In its role, MPZL3 contributes to the establishment of connections that are integral to cellular cohesion. The protein's function underscores its significance in the processes involving adhesion, emphasizing its role in maintaining the structural integrity and communication between neighboring cells. The homophilic nature of MPZL3-mediated cell adhesion highlights its specificity in fostering interactions between identical molecules, elucidating its pivotal role in various biological contexts where cellular adhesion is fundamental.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q6UWV2-1 (L32-S158)
-
Molecular Construction
-
N-term
-
MPZL3 (L32-S158)
Accession # Q6UWV2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MPZL3; Myelin Protein Zero-Like Protein 3; Myelin Protein Zero Like 3
-
AA Sequence
LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSS
-
Molecular Weight
Approximately 15-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
