MSRB3 Protein, Human (His)
Based on 1 Customer Validation
MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (His) is the recombinant human-derived MSRB3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (His) is the recombinant human-derived MSRB3 protein, expressed by E. coli , with N-His labeled tag.
MSRB3, a protein with the distinctive ability to catalyze the reduction of both free and protein-bound methionine sulfoxide to methionine, stands out for its crucial role in the auditory system. Specifically, isoform 2 of MSRB3 is deemed essential for normal hearing, underscoring its significance in auditory function.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q8IXL7-2 (G26-L185)
-
Molecular Construction
-
N-term
-
His
-
MSRB3 (G26-L185)
Accession # Q8IXL7-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MSRB3; Methionine-R-Sulfoxide Reductase B3, Mitochondrial; Prev. DFNB74; L-Methionine (R)-S-Oxide Reductase; Methionine-R-Sulfoxide Reductase B3; Deafness, Autosomal Recessive 74; DKFZp686C1178; MsrB3; FLJ36866; Methionine Sulfoxide Reductase B3; Peptide-
-
AA Sequence
GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
-
Predicted Molecular Mass
19.6 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
/
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
