MSRB3 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (His) is the recombinant human-derived MSRB3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (His) is the recombinant human-derived MSRB3 protein, expressed by E. coli , with N-His labeled tag.

Background

MSRB3, a protein with the distinctive ability to catalyze the reduction of both free and protein-bound methionine sulfoxide to methionine, stands out for its crucial role in the auditory system. Specifically, isoform 2 of MSRB3 is deemed essential for normal hearing, underscoring its significance in auditory function.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • MSRB3 (G26-L185)
      Accession # Q8IXL7-2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MSRB3; Methionine-R-Sulfoxide Reductase B3, Mitochondrial; Prev. DFNB74; L-Methionine (R)-S-Oxide Reductase; Methionine-R-Sulfoxide Reductase B3; Deafness, Autosomal Recessive 74; DKFZp686C1178; MsrB3; FLJ36866; Methionine Sulfoxide Reductase B3; Peptide-

  • AA Sequence

    GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

/

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00