¹⁵N-Labeled PD-L1 Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NZQ7-1 (A18-Y134)
-
Gene ID29126
-
Molecular Construction
-
N-term
-
6*His
-
(A18-Y134)
Accession # Q9NZQ7-1PD-L1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
¹⁵N-PD-L1; ¹⁵N-CD274; ¹⁵N-B7-H1; ¹⁵N-B7H1; PDCD1LG1; ¹⁵N-Programmed death ligand 1; CD274; B7 Homolog 1; Prev. PDCD1LG1; B7-H; PD-L1; PDCD1 Ligand 1; B7H1; PDCD1L1; PDL1; HPD-L1; Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; CD274 Antigen; ADMIO5; CD274 Molecule; B7-H1
-
AA Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
