NEK7 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (His-SUMO) is the recombinant human-derived NEK7 protein, expressed by E. coli , with N-6*His-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (His-SUMO) is the recombinant human-derived NEK7 protein, expressed by E. coli , with N-6*His-SUMO labeled tag.

Background

NEK7 protein, a pivotal kinase, plays a crucial role in mitotic cell cycle progression by contributing to the microtubule nucleation activity of the centrosome, ensuring robust mitotic spindle formation, and facilitating cytokinesis. Its diverse functions include the phosphorylation of EML4 at 'Ser-146,' promoting dissociation from microtubules during mitosis and thereby facilitating efficient chromosome congression. NEK7 extends its impact beyond mitotic events by phosphorylating RPS6KB1 and serving as an essential activator of the NLRP3 inflammasome assembly. Independently of its kinase activity, NEK7 unlocks NLRP3 within the microtubule organizing center, promoting the formation of the NLRP3:PYCARD complex and activation of CASP1. Notably, NEK7 acts as a cellular switch, ensuring mutual exclusivity between the inflammasome response and cell division; its interaction with NEK9 prevents interaction with NLRP3 and inflammasome activation during mitosis. These multifaceted functions position NEK7 as a key orchestrator in both mitotic progression and the inflammasome response, highlighting its regulatory significance in diverse cellular processes.

Verified Bioactivity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • NEK7 (M1-S302)
      Accession # Q8TDX7-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    NEK7; Never In Mitosis A-Related Kinase 7; NIMA Related Kinase 7; NimA-Related Protein Kinase 7; NIMA (Never In Mitosis Gene A)-Related Kinase 7; NEK6-Subfamily Protein Kinase; Serine/Threonine-Protein Kinase Nek7

  • AA Sequence

    MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS

  • Predicted Molecular Mass

    47.5 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00