NEK7 Protein, Human (His-SUMO)
Based on 1 Customer Validation
The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (His-SUMO) is the recombinant human-derived NEK7 protein, expressed by E. coli , with N-6*His-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (His-SUMO) is the recombinant human-derived NEK7 protein, expressed by E. coli , with N-6*His-SUMO labeled tag.
Background
NEK7 protein, a pivotal kinase, plays a crucial role in mitotic cell cycle progression by contributing to the microtubule nucleation activity of the centrosome, ensuring robust mitotic spindle formation, and facilitating cytokinesis. Its diverse functions include the phosphorylation of EML4 at 'Ser-146,' promoting dissociation from microtubules during mitosis and thereby facilitating efficient chromosome congression. NEK7 extends its impact beyond mitotic events by phosphorylating RPS6KB1 and serving as an essential activator of the NLRP3 inflammasome assembly. Independently of its kinase activity, NEK7 unlocks NLRP3 within the microtubule organizing center, promoting the formation of the NLRP3:PYCARD complex and activation of CASP1. Notably, NEK7 acts as a cellular switch, ensuring mutual exclusivity between the inflammasome response and cell division; its interaction with NEK9 prevents interaction with NLRP3 and inflammasome activation during mitosis. These multifaceted functions position NEK7 as a key orchestrator in both mitotic progression and the inflammasome response, highlighting its regulatory significance in diverse cellular processes.
Verified Bioactivity
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q8TDX7-1 (M1-S302)
-
Gene ID140609
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
NEK7 (M1-S302)
Accession # Q8TDX7-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NEK7; Never In Mitosis A-Related Kinase 7; NIMA Related Kinase 7; NimA-Related Protein Kinase 7; NIMA (Never In Mitosis Gene A)-Related Kinase 7; NEK6-Subfamily Protein Kinase; Serine/Threonine-Protein Kinase Nek7
-
AA Sequence
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS
-
Predicted Molecular Mass
47.5 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)