1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-BB Protein, Cynomolgus (HEK293, mFc)

PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived PDGF-BB, expressed by HEK293, with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived PDGF-BB, expressed by HEK293, with N-mFc labeled tag.

Background

PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB is a potent pleiotropic factor that promotes tumor growth and metastasis through the following three mechanisms: direct stimulation of tumor cell growth, stimulation of angiogenesis, and stimulation of lymphangiogenesis and metastasis[1].

Biological Activity

Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 5.317 ng/mL, corresponding to a specific activity is 1.88×105 units/mg.

Species

Cynomolgus

Source

HEK293

Tag

N-mFc

Accession

EHH65851.1 (S82-P190)

Gene ID

/

Protein Length

Partial

Synonyms
Platelet-derived growth factor subunit B; PDGF-2; PDGFB
AA Sequence

SLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSP

Predicted Molecular Mass
38 kDa
Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDGF-BB Protein, Cynomolgus (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDGF-BB Protein, Cynomolgus (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-BB Protein, Cynomolgus (HEK293, mFc)
Cat. No.:
HY-P75966A
Quantity:
MCE Japan Authorized Agent: