PDGF-BB Protein, Cynomolgus (HEK293, mFc)
Based on 1 Customer Validation
PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived PDGF-BB, expressed by HEK293, with N-mFc labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived PDGF-BB, expressed by HEK293, with N-mFc labeled tag.
Background
PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB is a potent pleiotropic factor that promotes tumor growth and metastasis through the following three mechanisms: direct stimulation of tumor cell growth, stimulation of angiogenesis, and stimulation of lymphangiogenesis and metastasis[1].
Verified Bioactivity
Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 5.317 ng/mL, corresponding to a specific activity is 1.88×105 units/mg.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-mFc
-
Accession
EHH65851.1 (S82-P190)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSP
-
Predicted Molecular Mass
38 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
