PLBD2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag.
PLBD2 Protein, identified as a putative phospholipase, engages in interactions with IGF2R. Although the specific enzymatic activities and detailed functional roles of PLBD2 are yet to be fully characterized, its association with IGF2R suggests a potential involvement in cellular signaling pathways related to insulin-like growth factor 2 receptor-mediated processes. While the precise contribution of PLBD2 to cellular homeostasis and phospholipid metabolism remains unclear, its interaction with IGF2R hints at a possible connection to pathways associated with growth and development. Further research is needed to uncover the specific functions of PLBD2 and elucidate its role in cellular physiology and signaling cascades.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
Q8NHP8-1 (I42-D589)
-
Molecular Construction
-
N-term
-
PLBD2 (I42-D589)
Accession # Q8NHP8 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
PLBD2; PLBL2; Phospholipase B Domain Containing 2; Phospholipase B-Like 2 32 KDa Form; P76; Phospholipase B-Like 2 45 KDa Form; Lamina Ancestor Homolog 2; Putative Phospholipase B-Like 2; LAMA-Like Protein 2; PLB Homolog 2 (Dictyostelium); Mannose-6-Phosp
-
AA Sequence
IPAPGGRWARDGQVPPASRSRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWD
-
Molecular Weight
Approximately 68 kDa & 46 & 34 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
