PLBD2 Protein, Human (HEK293, His)

The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag. The total length of PLBD2 Protein, Human (HEK293, His) is 548 a.a., with molecular weight of ~80 & 45 & 32 kDa, respectively.

PLBD2 Protein, identified as a putative phospholipase, engages in interactions with IGF2R. Although the specific enzymatic activities and detailed functional roles of PLBD2 are yet to be fully characterized, its association with IGF2R suggests a potential involvement in cellular signaling pathways related to insulin-like growth factor 2 receptor-mediated processes. While the precise contribution of PLBD2 to cellular homeostasis and phospholipid metabolism remains unclear, its interaction with IGF2R hints at a possible connection to pathways associated with growth and development. Further research is needed to uncover the specific functions of PLBD2 and elucidate its role in cellular physiology and signaling cascades.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-10*His

Q8NHP8-1 (I42-D589)

196463  [NCBI]

IPAPGGRWARDGQVPPASRSRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWD

Approximately 80 & 45 & 32 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.