1. Recombinant Proteins
  2. Others
  3. PNLIPRP2 Protein, Human (sf9, His)

The PLRP2 protein is a multifunctional lipase that hydrolyzes triglycerides and galactosylglycerides with broad substrate specificity. It is essential for newborns and plays an important role in the pancreas' digestion of dietary fats, especially milk fat globules, which are rich in long-chain triglycerides. PNLIPRP2 Protein, Human (sf9, His) is the recombinant human-derived PLRP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLRP2 protein is a multifunctional lipase that hydrolyzes triglycerides and galactosylglycerides with broad substrate specificity. It is essential for newborns and plays an important role in the pancreas' digestion of dietary fats, especially milk fat globules, which are rich in long-chain triglycerides. PNLIPRP2 Protein, Human (sf9, His) is the recombinant human-derived PLRP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

PLRP2, a versatile lipase, is a key player in the hydrolysis of triglycerides and galactosylglycerides, exhibiting broad substrate specificity without apparent positional preferences. Particularly crucial in neonates, PLRP2 plays a major role in pancreatic digestion of dietary fats, such as milk fat globules enriched in long-chain triglycerides. As the liver matures and bile salt synthesis increases, PLRP2 likely functions primarily as a galactolipase and monoacylglycerol lipase, efficiently hydrolyzing monogalactosyldiglycerols and digalactosyldiacylglycerols present in plant-based diets. In collaboration with LIPF, PLRP2 contributes to the hydrolysis of partially digested triglycerides. Additionally, in cytotoxic T cells, PLRP2 contributes to perforin-dependent cell lysis, while also exhibiting low phospholipase activity. In neurons, PLRP2 plays a crucial role in the localization of specific phospholipids to neurite tips, facilitating the surface expression of the dopamine transporter SLC6A3/DAT through intricate membrane domain remodeling and vesicle fusion events.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P54317 (K18-C469)

Gene ID
Molecular Construction
N-term
PLRP2 (K18-C469)
Accession # P54317
His
C-term
Protein Length

Full Length

Synonyms
Pancreatic lipase-related protein 2; PL-RP2; Galactolipase; PNLIPRP2
AA Sequence

KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKISVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC

Predicted Molecular Mass
51.6 kDa
Molecular Weight

Approximately 57 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PNLIPRP2 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PNLIPRP2 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PNLIPRP2 Protein, Human (sf9, His)
Cat. No.:
HY-P77149
Quantity:
MCE Japan Authorized Agent: