PNLIPRP2 Protein, Human (sf9, His)

The PLRP2 protein is a multifunctional lipase that hydrolyzes triglycerides and galactosylglycerides with broad substrate specificity. It is essential for newborns and plays an important role in the pancreas' digestion of dietary fats, especially milk fat globules, which are rich in long-chain triglycerides. PNLIPRP2 Protein, Human (sf9, His) is the recombinant human-derived PLRP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PLRP2 protein is a multifunctional lipase that hydrolyzes triglycerides and galactosylglycerides with broad substrate specificity. It is essential for newborns and plays an important role in the pancreas' digestion of dietary fats, especially milk fat globules, which are rich in long-chain triglycerides. PNLIPRP2 Protein, Human (sf9, His) is the recombinant human-derived PLRP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

PLRP2, a versatile lipase, is a key player in the hydrolysis of triglycerides and galactosylglycerides, exhibiting broad substrate specificity without apparent positional preferences. Particularly crucial in neonates, PLRP2 plays a major role in pancreatic digestion of dietary fats, such as milk fat globules enriched in long-chain triglycerides. As the liver matures and bile salt synthesis increases, PLRP2 likely functions primarily as a galactolipase and monoacylglycerol lipase, efficiently hydrolyzing monogalactosyldiglycerols and digalactosyldiacylglycerols present in plant-based diets. In collaboration with LIPF, PLRP2 contributes to the hydrolysis of partially digested triglycerides. Additionally, in cytotoxic T cells, PLRP2 contributes to perforin-dependent cell lysis, while also exhibiting low phospholipase activity. In neurons, PLRP2 plays a crucial role in the localization of specific phospholipids to neurite tips, facilitating the surface expression of the dopamine transporter SLC6A3/DAT through intricate membrane domain remodeling and vesicle fusion events.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PLRP2 (K18-C469)
      Accession # P54317
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PNLIPRP2; Cytotoxic T Lymphocyte Lipase; Pancreatic Lipase Related Protein 2 (Gene/Pseudogene); Galactolipase; PLRP2; Pancreatic Lipase Related Protein 2; Triacylglycerol Lipase; Pancreatic Lipase; Pancreatic Lipase-Related Protein 2; PL-RP2

  • AA Sequence

    KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKISVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC

  • Predicted Molecular Mass

    51.6 kDa

  • Molecular Weight

    Approximately 57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00