PSMA Protein, Human (Biotinylated, HEK293, His-Avi)

PSMA protein, with a preference for tri-alpha-glutamate peptides, acts as a folate hydrolase and NAALADase enzyme. It uptakes folate in the intestines, modulates excitatory neurotransmission by hydrolyzing NAAG to release glutamate in the brain, and exhibits dipeptidyl-peptidase IV type activity by cleaving Gly-Pro-AMC in vitro. PSMA, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PSMA protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PSMA protein, with a preference for tri-alpha-glutamate peptides, acts as a folate hydrolase and NAALADase enzyme. It uptakes folate in the intestines, modulates excitatory neurotransmission by hydrolyzing NAAG to release glutamate in the brain, and exhibits dipeptidyl-peptidase IV type activity by cleaving Gly-Pro-AMC in vitro. PSMA, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PSMA protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.

Background

PSMA, a multifaceted enzyme, showcases both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activities, displaying a notable preference for tri-alpha-glutamate peptides. It plays a crucial role in the intestinal uptake of folate, contributing to essential metabolic processes. Within the brain, PSMA acts as a modulator of excitatory neurotransmission by hydrolyzing the neuropeptide N-acetylaspartylglutamate (NAAG), leading to the release of glutamate. Notably, PSMA's involvement in prostate tumor progression highlights its potential significance in cancer biology. Additionally, the enzyme exhibits dipeptidyl-peptidase IV type activity and effectively cleaves Gly-Pro-AMC in vitro, further emphasizing its diverse enzymatic functions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-Avi;N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-Avi
    • PSMA (K44-A750)
      Accession # Q04609-1/NP_004467.1
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    FOLH1; Folylpoly-Gamma-Glutamate Carboxypeptidase; Prev. FOLH; Membrane Glutamate Carboxypeptidase; NAALAD1; Glutamate Carboxylase II; GCPII; NAALADase I; PSMA; NAALAdase; PSM; FGCP; Glutamate Carboxypeptidase II; MGCP; Glutamate Carboxypeptidase 2; Folat

  • AA Sequence

    KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

  • Predicted Molecular Mass

    82.4 kDa.

  • Molecular Weight

    Approximately 95-115 kDa, based on Bis-Tris PAGEunder reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00