PSMA Protein, Human (Biotinylated, HEK293, His-Avi)
PSMA protein, with a preference for tri-alpha-glutamate peptides, acts as a folate hydrolase and NAALADase enzyme. It uptakes folate in the intestines, modulates excitatory neurotransmission by hydrolyzing NAAG to release glutamate in the brain, and exhibits dipeptidyl-peptidase IV type activity by cleaving Gly-Pro-AMC in vitro. PSMA, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PSMA protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PSMA protein, with a preference for tri-alpha-glutamate peptides, acts as a folate hydrolase and NAALADase enzyme. It uptakes folate in the intestines, modulates excitatory neurotransmission by hydrolyzing NAAG to release glutamate in the brain, and exhibits dipeptidyl-peptidase IV type activity by cleaving Gly-Pro-AMC in vitro. PSMA, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PSMA protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
Background
PSMA, a multifaceted enzyme, showcases both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activities, displaying a notable preference for tri-alpha-glutamate peptides. It plays a crucial role in the intestinal uptake of folate, contributing to essential metabolic processes. Within the brain, PSMA acts as a modulator of excitatory neurotransmission by hydrolyzing the neuropeptide N-acetylaspartylglutamate (NAAG), leading to the release of glutamate. Notably, PSMA's involvement in prostate tumor progression highlights its potential significance in cancer biology. Additionally, the enzyme exhibits dipeptidyl-peptidase IV type activity and effectively cleaves Gly-Pro-AMC in vitro, further emphasizing its diverse enzymatic functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-His
-
Accession
Q04609-1/NP_004467.1 (K44-A750)
-
Gene ID2346
-
Molecular Construction
-
N-term
-
His-Avi
-
PSMA (K44-A750)
Accession # Q04609-1/NP_004467.1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
FOLH1; Folylpoly-Gamma-Glutamate Carboxypeptidase; Prev. FOLH; Membrane Glutamate Carboxypeptidase; NAALAD1; Glutamate Carboxylase II; GCPII; NAALADase I; PSMA; NAALAdase; PSM; FGCP; Glutamate Carboxypeptidase II; MGCP; Glutamate Carboxypeptidase 2; Folat
-
AA Sequence
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
-
Predicted Molecular Mass
82.4 kDa.
-
Molecular Weight
Approximately 95-115 kDa, based on Bis-Tris PAGEunder reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
