1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. RNF14 Protein, Human (His)

The RNF14 protein is a critical E3 ubiquitin protein ligase that leads to activation of the RNF14-RNF25 translation quality control pathway during ribosome stalling. RNF14 is recruited by GCN1 to ubiquitinate and degrade translation factors, mainly EEF1A1/eEF1A, as well as ETF1/eRF1 and ribosomal proteins (RPL0, RPL1, RPL12, RPS13, RPS17). RNF14 Protein, Human (His) is the recombinant human-derived RNF14 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RNF14 protein is a critical E3 ubiquitin protein ligase that leads to activation of the RNF14-RNF25 translation quality control pathway during ribosome stalling. RNF14 is recruited by GCN1 to ubiquitinate and degrade translation factors, mainly EEF1A1/eEF1A, as well as ETF1/eRF1 and ribosomal proteins (RPL0, RPL1, RPL12, RPS13, RPS17). RNF14 Protein, Human (His) is the recombinant human-derived RNF14 protein, expressed by E. coli , with N-6*His labeled tag.

Background

RNF14 Protein serves as a pivotal E3 ubiquitin-protein ligase in the RNF14-RNF25 translation quality control pathway, specifically activated when ribosomes stall during translation. In response to ribosome collision sensed by GCN1, RNF14 is recruited to stalled ribosomes, catalyzing the ubiquitination and subsequent degradation of translation factors, with a primary target being EEF1A1/eEF1A. This orchestrated process extends to the ubiquitination and degradation of other translation factors, including ETF1/eRF1 and several ribosomal proteins, such as RPL0, RPL1, RPL12, RPS13, and RPS17. Independently of its role in translational control, RNF14 assumes a regulatory role in Wnt signaling by interacting with TCF transcription factors (TCF7/TCF1, TCF7L1/TCF3, and TCF7L2/TCF4). Furthermore, it may act as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription, underscoring its multifunctional role in cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UBS8 (S2-D474)

Gene ID

9604

Molecular Construction
N-term
6*His
RNF14 (S2-D474)
Accession # Q9UBS8
C-term
Protein Length

Partial

Synonyms
RNF14; E3 ubiquitin-protein ligase RNF14; Androgen receptor-associated protein 54; HFB30; RING finger protein 14; Triad2 protein
AA Sequence

SSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

Molecular Weight

Approximately 55.8 KDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20%glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RNF14 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF14 Protein, Human (His)
Cat. No.:
HY-P701559
Quantity:
MCE Japan Authorized Agent: