RNF14 Protein, Human (His)
Based on 1 Customer Validation
The RNF14 protein is a critical E3 ubiquitin protein ligase that leads to activation of the RNF14-RNF25 translation quality control pathway during ribosome stalling. RNF14 is recruited by GCN1 to ubiquitinate and degrade translation factors, mainly EEF1A1/eEF1A, as well as ETF1/eRF1 and ribosomal proteins (RPL0, RPL1, RPL12, RPS13, RPS17). RNF14 Protein, Human (His) is the recombinant human-derived RNF14 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The RNF14 protein is a critical E3 ubiquitin protein ligase that leads to activation of the RNF14-RNF25 translation quality control pathway during ribosome stalling. RNF14 is recruited by GCN1 to ubiquitinate and degrade translation factors, mainly EEF1A1/eEF1A, as well as ETF1/eRF1 and ribosomal proteins (RPL0, RPL1, RPL12, RPS13, RPS17). RNF14 Protein, Human (His) is the recombinant human-derived RNF14 protein, expressed by E. coli , with N-6*His labeled tag.
RNF14 Protein serves as a pivotal E3 ubiquitin-protein ligase in the RNF14-RNF25 translation quality control pathway, specifically activated when ribosomes stall during translation. In response to ribosome collision sensed by GCN1, RNF14 is recruited to stalled ribosomes, catalyzing the ubiquitination and subsequent degradation of translation factors, with a primary target being EEF1A1/eEF1A. This orchestrated process extends to the ubiquitination and degradation of other translation factors, including ETF1/eRF1 and several ribosomal proteins, such as RPL0, RPL1, RPL12, RPS13, and RPS17. Independently of its role in translational control, RNF14 assumes a regulatory role in Wnt signaling by interacting with TCF transcription factors (TCF7/TCF1, TCF7L1/TCF3, and TCF7L2/TCF4). Furthermore, it may act as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription, underscoring its multifunctional role in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UBS8 (S2-D474)
-
Gene ID9604
-
Molecular Construction
-
N-term
-
6*His
-
RNF14 (S2-D474)
Accession # Q9UBS8 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RNF14; RING Finger Protein 14; Ring Finger Protein 14; CDNA FLJ58064, Highly Similar To RING Finger Protein 14; ARA54; Androgen Receptor Associated Protein 54; HFB30; Androgen Receptor-Associated Protein 54; E3 Ubiquitin-Protein Ligase RNF14; RBR-Type E3
-
AA Sequence
SSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
-
Predicted Molecular Mass
55.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20%glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
