ST3GAL4 Protein, Human (HEK293, His-HA)
Based on 1 Customer Validation
The ST3GAL4 protein is a β-galactoside α2-3 sialyltransferase essential for the sialylation of glycoproteins and glycolipids. It mediates hemostasis by sialylating VWF, preventing ASGPR recognition and clearance, and regulating platelet clearance. ST3GAL4 Protein, Human (HEK293, His-HA) is the recombinant human-derived ST3GAL4 protein, expressed by HEK293 , with C-His, N-HA labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The ST3GAL4 protein is a β-galactoside α2-3 sialyltransferase essential for the sialylation of glycoproteins and glycolipids. It mediates hemostasis by sialylating VWF, preventing ASGPR recognition and clearance, and regulating platelet clearance. ST3GAL4 Protein, Human (HEK293, His-HA) is the recombinant human-derived ST3GAL4 protein, expressed by HEK293 , with C-His, N-HA labeled tag.
Background
The ST3GAL4 protein functions as a beta-galactoside alpha2-3 sialyltransferase, playing a pivotal role in the terminal sialylation of glycoproteins and glycolipids. This enzymatic activity involves catalyzing the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc- and Galbeta-(1->4)-GlcNAc-terminated glycoconjugates through an alpha2-3 linkage. Notably, ST3GAL4 is a key player in hemostasis, being responsible for the sialylation of plasma VWF/von Willebrand factor, preventing its recognition by asialoglycoprotein receptors (ASGPR) and subsequent clearance. Additionally, it regulates ASGPR-mediated clearance of platelets. The protein is integral to the biosynthesis of sialyl Lewis X epitopes on O- and N-glycans, crucial for the recognition by SELE/E-selectin, SELP/P-selectin, and SELL/L-selectin, thereby facilitating selectin-mediated rolling and adhesion of leukocytes during extravasation. ST3GAL4 also contributes to the adhesion and transendothelial migration of neutrophils, likely through the terminal sialylation of CXCR2. In glycosphingolipid biosynthesis, ST3GAL4 sialylates GM1 and GA1 gangliosides to form GD1a and GM1b, respectively, and metabolizes brain c-series ganglioside GT1c to form GQ1c. Furthermore, it synthesizes ganglioside LM1, a major structural component of peripheral nerve myelin.
Verified Bioactivity
1. Measured by its ability to transfer Neu5Ac from CMP-Neu5Ac to alpha –Lactose that incubate at 37°C for 30min .The specific activity is 499.44 pmol/min/μg.
2. Western blot analysis of protein Human ST3GAL4 (lane 2 (10ng) and lane 3 (20ng)) using HA Tag (HRP) (HY-P80948A) Rabbit mAb. Proteins were transferred to a PVDF membrane and blocked with 5% non-fat milk in TBST for 2 hour at room temperature. The primary antibody (1/1000) in 5% non-fat milk in TBST at 4°C overnight.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Characterization - Western Blot
Characterization - Western Blot
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His;N-HA
-
Accession
Q11206 (E41-F333)
-
Molecular Construction
-
N-term
-
HA
-
ST3GAL4 (E41-F333)
Accession # Q11206 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ST3GAL4; Sialyltransferase 4C (Beta-Galactosidase Alpha-2,3-Sialytransferase); Prev. NANTA3; Sialyltransferase 4C; Prev. SIAT4C; Alpha 2,3-ST 4; Prev. CGS23; ST3GalA.2; Prev. SIAT4; Gal-NAc6S; STZ; FLJ11867; CMP-N-Acetylneuraminate-Beta-Galactosamide-Alpha-2,3-Sialyltransferase 4; ST3GalIV; N-Acetyllactosaminide Alpha-2,3-Sialyltransferase; ST-4; Gal-Beta-1,3-GalNAc-Alpha-2,3-Sialyltransferase; Sialyltransferase 4C (Beta-Galactoside Alpha-2,3-Sialytransferase); Gal-Beta-1,4-GlcNAc-Alpha-2,3-Sialyltransferase; Gal-Beta-1,4-GalNAc-Alpha-2,3-Sialyltransferase; Alpha 2,3-Sialyltransferase IV; Alpha-3-N-Acetylneuraminyltransferase; ST3Gal IV; SIAT4-C; SAT3; SAT-3; ST3 Beta-Galactoside Alpha-2,3-Sialyltransferase 4; Beta-Galactoside Alpha-2,3-Sialyltransferase 4
-
AA Sequence
EKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
-
Predicted Molecular Mass
35.4 kDa
-
Molecular Weight
Approximately 45-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)