1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ST3GAL4 Protein, Human (HEK293, His-HA)

The ST3GAL4 protein is a β-galactoside α2-3 sialyltransferase essential for the sialylation of glycoproteins and glycolipids. It mediates hemostasis by sialylating VWF, preventing ASGPR recognition and clearance, and regulating platelet clearance. ST3GAL4 Protein, Human (HEK293, His-HA) is the recombinant human-derived ST3GAL4 protein, expressed by HEK293 , with C-His, N-HA labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg Get quote
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ST3GAL4 protein is a β-galactoside α2-3 sialyltransferase essential for the sialylation of glycoproteins and glycolipids. It mediates hemostasis by sialylating VWF, preventing ASGPR recognition and clearance, and regulating platelet clearance. ST3GAL4 Protein, Human (HEK293, His-HA) is the recombinant human-derived ST3GAL4 protein, expressed by HEK293 , with C-His, N-HA labeled tag.

Background

The ST3GAL4 protein functions as a beta-galactoside alpha2-3 sialyltransferase, playing a pivotal role in the terminal sialylation of glycoproteins and glycolipids. This enzymatic activity involves catalyzing the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc- and Galbeta-(1->4)-GlcNAc-terminated glycoconjugates through an alpha2-3 linkage. Notably, ST3GAL4 is a key player in hemostasis, being responsible for the sialylation of plasma VWF/von Willebrand factor, preventing its recognition by asialoglycoprotein receptors (ASGPR) and subsequent clearance. Additionally, it regulates ASGPR-mediated clearance of platelets. The protein is integral to the biosynthesis of sialyl Lewis X epitopes on O- and N-glycans, crucial for the recognition by SELE/E-selectin, SELP/P-selectin, and SELL/L-selectin, thereby facilitating selectin-mediated rolling and adhesion of leukocytes during extravasation. ST3GAL4 also contributes to the adhesion and transendothelial migration of neutrophils, likely through the terminal sialylation of CXCR2. In glycosphingolipid biosynthesis, ST3GAL4 sialylates GM1 and GA1 gangliosides to form GD1a and GM1b, respectively, and metabolizes brain c-series ganglioside GT1c to form GQ1c. Furthermore, it synthesizes ganglioside LM1, a major structural component of peripheral nerve myelin.

Biological Activity

1. Measured by its ability to transfer Neu5Ac from CMP-Neu5Ac to alpha –Lactose that incubate at 37°C for 30min .The specific activity is 499.44 pmol/min/μg.
2. Western blot analysis of protein Human ST3GAL4 (lane 2 (10ng) and lane 3 (20ng)) using HA Tag (HRP) (HY-P80948A) Rabbit mAb. Proteins were transferred to a PVDF membrane and blocked with 5% non-fat milk in TBST for 2 hour at room temperature. The primary antibody (1/1000) in 5% non-fat milk in TBST at 4°C overnight.

Species

Human

Source

HEK293

Tag

C-8*His;N-HA

Accession

Q11206 (E41-F333)

Gene ID
Molecular Construction
N-term
HA
ST3GAL4 (E41-F333)
Accession # Q11206
8*His
C-term
Protein Length

Partial

Synonyms
Sialyltransferase 4C; SIAT4; SIAT4C; SIAT4-C; ST3Gal IV; ST3GAL4; ST3GalA.2; ST-4; STZSIAT4; Alpha 2,3-ST 4; CGS23; CGS23FLJ46764; FLJ11867; Gal-NAc 6S; NANTA3; SAT3; SAT-3
AA Sequence

EKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Predicted Molecular Mass
35.4 kDa
Molecular Weight

Approximately 48-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

ST3GAL4 Protein, Human (HEK293, His-HA) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ST3GAL4 Protein, Human (HEK293, His-HA)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ST3GAL4 Protein, Human (HEK293, His-HA)
Cat. No.:
HY-P77849
Quantity:
MCE Japan Authorized Agent: