1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ST8SIA1 Protein, Human (HEK293, His)

The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ST8SIA1 protein catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of ganglioside GM3, leading to the formation of ganglioside GD3. Gangliosides represent a subfamily of complex glycosphingolipids characterized by the presence of one or more sialic acid residues. This enzymatic activity extends to the potential addition of a second alpha-2,8-sialic acid to GD3, resulting in the formation of GT3. ST8SIA1 can also utilize GM1b, GD1a, and GT1b as acceptor substrates to synthesize GD1c, GT1a, and GQ1b, respectively. Notably, in breast cancer cells, ST8SIA1 exhibits the ability to synthesize unconventional tetra- and pentasialylated lactosylceramide derivatives identified as GQ3 (II3Neu5Ac4-Gg2Cer) and GP3 (II3Neu5Ac5-Gg2Cer). This diverse enzymatic repertoire underscores ST8SIA1's role in ganglioside biosynthesis, contributing to the structural complexity and functional diversity of these glycosphingolipids in cellular processes and disease contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q92185 (Y49-S356)

Gene ID
Molecular Construction
N-term
ST8SIA1 (Y49-S356)
Accession # Q92185
6*His
C-term
Protein Length

Lumenal Domain

Synonyms
Alpha-N-Acetylneuraminide Alpha-2; 8-Sialyltransferase; Alpha-2; 8-Sialyltransferase 8A; Ganglioside GD3 Synthase; Ganglioside GT3 Synthase; Sialyltransferase 8A; SIAT8-A; Sialytransferase St8Sia I; ST8SiaI; ST8SIA1; SIAT8; SIAT8A
AA Sequence

YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

Predicted Molecular Mass
36.2 kDa
분자량

Approximately 48 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

ST8SIA1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ST8SIA1 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ST8SIA1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71334
수량:
MCE Japan Authorized Agent: