ST8SIA1 Protein, Human (HEK293, His)
The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
ST8SIA1 protein catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of ganglioside GM3, leading to the formation of ganglioside GD3. Gangliosides represent a subfamily of complex glycosphingolipids characterized by the presence of one or more sialic acid residues. This enzymatic activity extends to the potential addition of a second alpha-2,8-sialic acid to GD3, resulting in the formation of GT3. ST8SIA1 can also utilize GM1b, GD1a, and GT1b as acceptor substrates to synthesize GD1c, GT1a, and GQ1b, respectively. Notably, in breast cancer cells, ST8SIA1 exhibits the ability to synthesize unconventional tetra- and pentasialylated lactosylceramide derivatives identified as GQ3 (II3Neu5Ac4-Gg2Cer) and GP3 (II3Neu5Ac5-Gg2Cer). This diverse enzymatic repertoire underscores ST8SIA1's role in ganglioside biosynthesis, contributing to the structural complexity and functional diversity of these glycosphingolipids in cellular processes and disease contexts.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q92185 (Y49-S356)
-
Molecular Construction
-
N-term
-
ST8SIA1 (Y49-S356)
Accession # Q92185 -
6*His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
ST8SIA1; ST8SiaI; Prev. SIAT8A; Sialyltransferase 8A (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialyltransferase, GD3 Synthase); Prev. SIAT8; Ganglioside-Specific Alpha-2,8-Polysialyltransferase; Sialyltransferase 8 (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialy
-
AA Sequence
YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
-
Predicted Molecular Mass
36.2 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
