Tenascin/Tnc protein, Human (HEK293, His)
Based on 1 Customer Validation
TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc protein, Human (HEK293, His) is the recombinant human-derived Tenascin/Tnc protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
-
HY-P700834
Tenascin/Tnc protein, Mouse (HEK293, His) -
HY-11109
Resatorvid -
HY-P7044
IL-6 Protein, Human -
HY-P70593
Fibronectin Protein, Human -
HY-P70257
Integrin beta-1/CD29 Protein, Human (HEK293, His) -
HY-P75333
Collagen alpha-1(II) chain/COL2A1 Protein, Human (HEK293, His) -
HY-P71691
Tenascin/Tnc Protein, Human (His)
Biological Activity
Description
TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc protein, Human (HEK293, His) is the recombinant human-derived Tenascin/Tnc protein, expressed by HEK293 , with C-His labeled tag.
Background
The TNC protein, an extracellular matrix protein, plays a crucial role in guiding migrating neurons and axons during development, contributing to processes such as synaptic plasticity and neuronal regeneration. It facilitates neurite outgrowth from cortical neurons grown on a monolayer of astrocytes, indicative of its involvement in the intricate cellular interactions within the nervous system. Acting as a ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3, and alpha-V/beta-6, TNC establishes molecular connections essential for cellular communication and signaling. In the context of tumors, TNC stimulates angiogenesis by promoting the elongation, migration, and sprouting of endothelial cells. Structurally, TNC exists as a homohexamer, with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. This versatile protein also interacts with CSPG4, indicating its involvement in diverse cellular and molecular processes across different biological contexts.
Verified Bioactivity
Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. Tenascin immobilized at 15 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 70-80% NIH-3T3 cell adhesion (5×104 cells/well, 100 μL/well).
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P24821-1 (G23-S621)
-
Molecular Construction
-
N-term
-
Tenascin (G23-S621)
Accession # P24821-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNC; Neuronectin; Prev. HXB; Cytotactin; Prev. DFNA56; Tenascin-C; TN; MGC167029; Tenascin; GMEM; Glioma-Associated-Extracellular Matrix Antigen; TN-C; Deafness, Autosomal Dominant 56; JI; Tenascin-C Additional Domain 1; Hexabrachion (Tenascin C, Cytotact
-
AA Sequence
GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCS
-
Predicted Molecular Mass
65.3 kDa
-
Molecular Weight
Approximately 53-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
