TNF-alpha/TNFSF2 Protein, Mouse (HEK293, His)
TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen. It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2, Mouse (HEK293, His) is the recombinant mouse-derived TNF-alpha/TNFSF2 protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen. It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2, Mouse (HEK293, His) is the recombinant mouse-derived TNF-alpha/TNFSF2 protein, expressed by HEK293, with C-His labeled tag.
Background
TNF-alpha/TNFSF2 Protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Secreted mainly by macrophages, it can induce cell death in certain tumor cell lines. Additionally, it acts as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion and is implicated in the induction of cachexia. Under specific conditions, it can stimulate cell proliferation and promote cell differentiation. In adipocytes, it induces insulin resistance by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, while also leading to GKAP42 protein degradation, contributing to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Furthermore, it facilitates osteoclastogenesis, thereby mediating bone resorption. Finally, the TNF intracellular domain (ICD) form of TNF-alpha/TNFSF2 Protein stimulates IL12 production in dendritic cells.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P06804 (L80-L235)
-
Gene ID21926
-
Molecular Construction
-
N-term
-
TGF-α (L80-L235)
Accession # P06804 -
His
-
C-term
-
-
Protein Length
Full Length of TNF, soluble form
-
Synonyms
TNF; Tumor Necrosis Factor (TNF Superfamily, Member 2); Prev. TNFA; Tumor Necrosis Factor-Alpha; TNF-Alpha; Tumor Necrotic Factor Alpha; TNFSF2; TNF Superfamily, Member 2; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF, Macrophage-Derived; TNF-A;
-
AA Sequence
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
-
Predicted Molecular Mass
19.1 kDa
-
Molecular Weight
Approximately 19-20 kDa & 23-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)