Copy Link Print Information

TROP-2 Protein, Human (248a.a, HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TROP-2 Protein, Human (248a.a, HEK293, His)
  • Experimental Validation Results for TROP-2 Protein, Human (248a.a, HEK293, His)
  • TROP-2 Protein, Human (248a.a, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The TROP-2 protein emerges as a potential growth factor receptor, suggesting its involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth, proliferation, and potentially other cellular functions. The specific ligands and downstream pathways associated with TROP-2-mediated growth factor signaling remain areas for further investigation. Unraveling the detailed molecular mechanisms and functional implications of TROP-2 in growth factor signaling will contribute to a comprehensive understanding of its role in cellular physiology and may open avenues for therapeutic interventions targeting this receptor.

Verified Bioactivity

1.Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5x104 cells/well are added to Recombinant Human TROP-2 coated plates (10 µg/mL with 100 µL/well), >27% cells will adhere after 1 hour incubation.
2.Loaded Sacituzumab (HY-P99045) on AHC2 biosensor, can bind TROP-2 Protein, Human (248a.a, HEK293, His) with an affinity constant of 8.077E-10 M as determined in BLI assay.
3.Measured by its binding ability in a functional ELISA. Immobilized TROP-2 at 1 μg/mL can bind Sacituzumab (HY-P99045). The ED50 for this effect is 2.783 ng/mL.
4.Measured by its binding ability in a functional ELISA. Immobilized TROP-2 at 1 μg/mL can bind Sacituzumab tirumotecan (HY-164789). The ED50 for this effect is 2.250 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Sacituzumab (HY-P99045) on AHC2 biosensor, can bind TROP-2 Protein, Human (248a.a, HEK293, His) with an affinity constant of 8.077E-10 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P09758 (H27-T274)

  • Gene ID
    4070  [NCBI]
  • Molecular Construction
    • N-term
    • TROP-2 (H27-T274)
      Accession # P09758
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2; Cell Surface Glycoprotein TROP2; EGP-1; Truncated TACSTD2; Membrane Component Chromosome 1 Surface Marker 1; GA7331; Pancreatic Carcinoma Marker Protein GA733-1; EGP1; Trophoblast Cell Surface Antigen 2; GP50; Cell Surface Glycoprotein Trop-2; Tumor Associated Calcium Signal Transducer 2; 40kD Glycoprotein, Identified By Monoclonal Antibody GA733

  • AA Sequence

    HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

  • Predicted Molecular Mass

    28.9 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Loaded Sacituzumab (HY-P99045) on AHC2 biosensor, can bind TROP-2 Protein, Human (248a.a, HEK293, His) with an affinity constant of 8.077E-10 M as determined in BLI assay.

  • TROP-2 Protein, Human (248a.a, HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TROP-2 Protein, Human (248a.a, HEK293, His)
  • Experimental Validation Results for TROP-2 Protein, Human (248a.a, HEK293, His)
  • TROP-2 Protein, Human (248a.a, HEK293, His) Product Image